(data stored in ACNUC7421 zone)

EMBL: AM269962.PE14

AM269962.PE14        Location/Qualifiers
FT   CDS             complement(join(31082..31139,31460..31684,31767..31874,
FT                   31973..32083,32264..32419,32506..32546,32641..32754,
FT                   32935..33000,33086..33238))
FT                   /locus_tag="An01g04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H3"
FT                   /protein_id="CAK36970.1"
FT                   /translation="MAMSQFRLSIFGVPTVTPVHRTLQDVCEGTGTGSPPPEWGSYCMP
FT                   STRNILGKPITELVHKPKLNCSRLHRVGARRESRRTTLVKIDCIMTTARLILQSCPNDT
FT                   LQGNEDQEKLFPRWVPTAEVILEQTKRGNTLAGGSRAGVCTTECVHPVEHLRVEVRASR
FT                   KGYDLITRGADQPQANAAATLGEAKIADGYSAMSAAEEGPLLINCFARIAGGICFRNYS
FT                   YLYRLGLSCDLEIHSNHCRQFWTFMASREASRQDHLMPCGTAGLWQCASGLLTPGPFLF
FT                   LTVALHSSVHKGQGTRRRLSLPIHPSNRTMIYPRSRTNTFALRGGINWDNPPGHPWVAR
FT                   MAD"
     MAMSQFRLSI FGVPTVTPVH RTLQDVCEGT GTGSPPPEWG SYCMPSTRNI LGKPITELVH        60
     KPKLNCSRLH RVGARRESRR TTLVKIDCIM TTARLILQSC PNDTLQGNED QEKLFPRWVP       120
     TAEVILEQTK RGNTLAGGSR AGVCTTECVH PVEHLRVEVR ASRKGYDLIT RGADQPQANA       180
     AATLGEAKIA DGYSAMSAAE EGPLLINCFA RIAGGICFRN YSYLYRLGLS CDLEIHSNHC       240
     RQFWTFMASR EASRQDHLMP CGTAGLWQCA SGLLTPGPFL FLTVALHSSV HKGQGTRRRL       300
     SLPIHPSNRT MIYPRSRTNT FALRGGINWD NPPGHPWVAR MAD                         343
//

If you have problems or comments...

PBIL Back to PBIL home page