(data stored in ACNUC7421 zone)

EMBL: AM269962.PE15

AM269962.PE15        Location/Qualifiers
FT   CDS             join(34766..35369,35426..36192)
FT                   /locus_tag="An01g04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H4"
FT                   /protein_id="CAK36971.1"
FT                   /translation="MDLICSSPVVPAPIQEMVAEPIDIILDEPTDTCAMVEEKAEEIIE
FT                   AENERLDQLMIEFTRGFDPGTFVDEVSNSLPGILKDIFPGSYEHLLSMLFESDDKMHAT
FT                   QMKLEEWLLKRYPQVLNKIDTERQETNITDETYFGAEIEILRKMLAFLRKESDKPVFWL
FT                   NSRRASPSKAREQLEASIRVIELFKSDVMVAMKLDTEDRKIYNPLPVSTERTALLSIKQ
FT                   LRIDACKASLSWEGYMDSAIVLTSFFHAYKAYTCAHKPDKARAWGWLPPQGLAPPRLSA
FT                   EIAQVGDLVRWEFEHENGAFDLLLKTALWLGLARGLPAVHLFCDVARLFTTHKPSPTAN
FT                   EPYIRFLRHLAQTRVSIAGIKSTPSTPVPFKQSDENTNRGYFEDVVDSDKNLEKDLTKT
FT                   LSLLRINTARDIKLTATPPKCSFRKKAKMIEKACAVEENHTEKWPQKDPASQGNSFS"
     MDLICSSPVV PAPIQEMVAE PIDIILDEPT DTCAMVEEKA EEIIEAENER LDQLMIEFTR        60
     GFDPGTFVDE VSNSLPGILK DIFPGSYEHL LSMLFESDDK MHATQMKLEE WLLKRYPQVL       120
     NKIDTERQET NITDETYFGA EIEILRKMLA FLRKESDKPV FWLNSRRASP SKAREQLEAS       180
     IRVIELFKSD VMVAMKLDTE DRKIYNPLPV STERTALLSI KQLRIDACKA SLSWEGYMDS       240
     AIVLTSFFHA YKAYTCAHKP DKARAWGWLP PQGLAPPRLS AEIAQVGDLV RWEFEHENGA       300
     FDLLLKTALW LGLARGLPAV HLFCDVARLF TTHKPSPTAN EPYIRFLRHL AQTRVSIAGI       360
     KSTPSTPVPF KQSDENTNRG YFEDVVDSDK NLEKDLTKTL SLLRINTARD IKLTATPPKC       420
     SFRKKAKMIE KACAVEENHT EKWPQKDPAS QGNSFS                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page