(data stored in ACNUC7421 zone)

EMBL: AM269962.PE17

AM269962.PE17        Location/Qualifiers
FT   CDS             join(39790..39824,39953..40246,40319..40438,40510..40543)
FT                   /locus_tag="An01g04380"
FT                   /EC_number="2.7.7.6"
FT                   /note="Complex: S. cerevisiae Rpo26p is essential for the
FT                   assembly of RNA polymerase I and RNA polymerase II and for
FT                   the stability of the largest subunits of these enzymes."
FT                   /note="Function: the S. cerevisiae homolog RPO26 catalyses
FT                   DNA-template-directed extension of the 3'-end of an RNA
FT                   strand by one nucleotide at a time."
FT                   /note="Title: strong similarity to 23 kD subunit of
FT                   DNA-directed RNA polymerase I,II,III Rpo26 - Saccharomyces
FT                   cerevisiae"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2Q8H6"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H6"
FT                   /inference="profile:COGS:COG1758"
FT                   /inference="profile:PFAM:PF01192"
FT                   /inference="similar to AA sequence:PIR:RNBYR6"
FT                   /protein_id="CAK36973.1"
FT                   /translation="MSDYGDHDAEETYDYEPEQEYDDNEPEDFLNPEDVDVAEGGADEY
FT                   GEGSYAPAVNGNHIVASGDPNAGYAGKVMEQTREKKVPNDQRQTTPYMTKYERARVLGT
FT                   RALQISMNAPVLVDLEGETDPLQIAIKELNQKKIPLIVRRYLPDGWYEDWTCEELL"
     MSDYGDHDAE ETYDYEPEQE YDDNEPEDFL NPEDVDVAEG GADEYGEGSY APAVNGNHIV        60
     ASGDPNAGYA GKVMEQTREK KVPNDQRQTT PYMTKYERAR VLGTRALQIS MNAPVLVDLE       120
     GETDPLQIAI KELNQKKIPL IVRRYLPDGW YEDWTCEELL                             160
//

If you have problems or comments...

PBIL Back to PBIL home page