(data stored in ACNUC7421 zone)

EMBL: AM269962.PE2

AM269962.PE2         Location/Qualifiers
FT   CDS             join(3569..3648,3689..3955,4172..4308,4394..4626)
FT                   /locus_tag="An01g04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8G1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G1"
FT                   /protein_id="CAK36958.1"
FT                   /translation="MSGSHKPTPTPAKQAAVVQANGTVLTTWNLNGRTRPRLPFTFSNE
FT                   TLPTWLGSIVVLELLGTKLPFPSDKHGSPTRQLTCCLLIYNPIVCLARLTQPQMERDIL
FT                   SLTGHVDGGFRPCELRRFPRIAPSILSLRDAAVEGNHWKINLMWFDACRRSIDIERFAG
FT                   SSSAIVALSLGCAEIPLQLVYYTPAAAASPCYGQFHRTMSPTIHIPTFVCRYLHFLADL
FT                   SAQGQIRQNAAANPTS"
     MSGSHKPTPT PAKQAAVVQA NGTVLTTWNL NGRTRPRLPF TFSNETLPTW LGSIVVLELL        60
     GTKLPFPSDK HGSPTRQLTC CLLIYNPIVC LARLTQPQME RDILSLTGHV DGGFRPCELR       120
     RFPRIAPSIL SLRDAAVEGN HWKINLMWFD ACRRSIDIER FAGSSSAIVA LSLGCAEIPL       180
     QLVYYTPAAA ASPCYGQFHR TMSPTIHIPT FVCRYLHFLA DLSAQGQIRQ NAAANPTS         238
//

If you have problems or comments...

PBIL Back to PBIL home page