(data stored in ACNUC7421 zone)

EMBL: AM269962.PE21

AM269962.PE21        Location/Qualifiers
FT   CDS             join(46281..47002,47092..47665)
FT                   /locus_tag="An01g04420"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAE76116.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q8I0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I0"
FT                   /protein_id="CAK36977.1"
FT                   /translation="MPSIPPPLTISHRHTRSRSSNIDIDPISPGTYAPNGFSYRSPRSP
FT                   HTPRSSIPSSPVDVRPHHTQSFNGSHRMSGDFGGAGNEGGGLGNLADELADAWEEEEGG
FT                   YGYTSGQDTGAPDAQYVDRSDDEDAYHRMGTGARTPSSGYSSERNSSLQPPRPKTRNGA
FT                   HRHRRHESQYDGSDYGNDSDFEEADMPPSLEMQMAEIESLARRGLENNGSENDFVIQRA
FT                   VEALRDLGGQSGIENNAMRLITAHSSITSHLTHQTRALQTLTHPLLFSPFPLLSSDAID
FT                   ALIPLIDEELLPNLPYPFPEQPRHSSRPTTPSQSPALNPLVSLQTLVSQTSDITLSLRG
FT                   LSDTLYESRQLTSTASRRLRSARELVADLRREEEGVEEGTRWIERGDWDRRLRDREAGR
FT                   VCGDVVSGFEAVCGEWREKLFGAAAGAEVAAA"
     MPSIPPPLTI SHRHTRSRSS NIDIDPISPG TYAPNGFSYR SPRSPHTPRS SIPSSPVDVR        60
     PHHTQSFNGS HRMSGDFGGA GNEGGGLGNL ADELADAWEE EEGGYGYTSG QDTGAPDAQY       120
     VDRSDDEDAY HRMGTGARTP SSGYSSERNS SLQPPRPKTR NGAHRHRRHE SQYDGSDYGN       180
     DSDFEEADMP PSLEMQMAEI ESLARRGLEN NGSENDFVIQ RAVEALRDLG GQSGIENNAM       240
     RLITAHSSIT SHLTHQTRAL QTLTHPLLFS PFPLLSSDAI DALIPLIDEE LLPNLPYPFP       300
     EQPRHSSRPT TPSQSPALNP LVSLQTLVSQ TSDITLSLRG LSDTLYESRQ LTSTASRRLR       360
     SARELVADLR REEEGVEEGT RWIERGDWDR RLRDREAGRV CGDVVSGFEA VCGEWREKLF       420
     GAAAGAEVAA A                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page