(data stored in ACNUC7421 zone)

EMBL: AM269962.PE22

AM269962.PE22        Location/Qualifiers
FT   CDS             complement(join(49185..49701,49776..52150,52233..52457,
FT                   52588..52629))
FT                   /locus_tag="An01g04430"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor eIF-3 - Schizosaccharomyces pombe"
FT                   /note="cytoplasm"
FT                   /db_xref="GOA:A2Q8I1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR027512"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8I1"
FT                   /inference="profile:COGS:COG0542"
FT                   /inference="similar to AA sequence:PIR:T39716"
FT                   /protein_id="CAK36978.1"
FT                   /translation="MPPPPHIKPENVLKRAQELIAVGQAPAALNVLHEHVTSKRTRSSP
FT                   IASLEPVMLLFVELCVDLRKGKAAKDGLYQYKNIAQNTNVGTIEVVLKKFIELAEKKVT
FT                   EAQAKADEIQSSLESAAPSSNVDDLEAIETPETILLATVSGEQSRDRTDRAVVTPWLKF
FT                   LWETYRTVLEILKNNARLEVMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAKY
FT                   SAQMHAINLSDPDTLQRHLDTRFQQLNVAVELELWQEAFRSIEDIHTLLSLSKRPAKNV
FT                   MMANYYEKLARIFLVSENYLFHAAAFSRYYNLLRQSAAALAAGQGTKKENPSVTEADMT
FT                   KAASFVLLSALSIPVISTSRSRGALVDVDEVRKNKNTRLTNLLGMASPPTRAVLFKDAL
FT                   NKGLLKRARPEIRDLYNILEVDFHPLSICKKITPILKQIGADPEMEKYVLPLQQVILTR
FT                   LFQQLSQVYESVELKFVYELAQFPDPFQITPSMIEKFIMNGCKKGDLAIRVDHISGVLT
FT                   FDTDVFSSAKALHPGSAAGSAESEVGSVQRLQNTPAEIARLQLTRLAKTLHVTCMYVDP
FT                   SYNEARLQAKRAALARAEAGAAKEHEETLARRVIIEKKKEAATDALQRKQREEETRKRI
FT                   RTQQLQEAEKQRLLDEHREREKKRIKDEQDRIRQQELKKQLEELKTGVKGIDISELDLN
FT                   ELDANRLRAMKLAQLEKEKNELNDRIRTTAKRIDHLERAFRREELKHVPEDYEKQKQRD
FT                   MEIYEATKAEALKEAEDKHKEAVALKHRLSRLVPQFNSFRKEVSEKRHEEFEKRRKAAE
FT                   RDFEAKKMQRIKEVQERRRRERAEREEEERRRKEEEERIRREEEERTAKEEERRRVLAE
FT                   EKAKREEERKRLDELAAKQKQREEEAEARRAARRTGGAEPEAAPERAAPTERTAPRLNL
FT                   APRTGGAGPSWRERQAAKEAAGGTPAAPAAAAPEPAREEPAPVRRTGGYVPPHLRSGAS
FT                   ATPAAPAPAPSTERYVPRAMREAGSSQPPSRTQTPGSSSDKPEESKPAAGKWVPRWKQQ
FT                   QGGQ"
     MPPPPHIKPE NVLKRAQELI AVGQAPAALN VLHEHVTSKR TRSSPIASLE PVMLLFVELC        60
     VDLRKGKAAK DGLYQYKNIA QNTNVGTIEV VLKKFIELAE KKVTEAQAKA DEIQSSLESA       120
     APSSNVDDLE AIETPETILL ATVSGEQSRD RTDRAVVTPW LKFLWETYRT VLEILKNNAR       180
     LEVMYQTTAL QAFQFCLKYT RKTEFRRLCE LLRNHVQNAA KYSAQMHAIN LSDPDTLQRH       240
     LDTRFQQLNV AVELELWQEA FRSIEDIHTL LSLSKRPAKN VMMANYYEKL ARIFLVSENY       300
     LFHAAAFSRY YNLLRQSAAA LAAGQGTKKE NPSVTEADMT KAASFVLLSA LSIPVISTSR       360
     SRGALVDVDE VRKNKNTRLT NLLGMASPPT RAVLFKDALN KGLLKRARPE IRDLYNILEV       420
     DFHPLSICKK ITPILKQIGA DPEMEKYVLP LQQVILTRLF QQLSQVYESV ELKFVYELAQ       480
     FPDPFQITPS MIEKFIMNGC KKGDLAIRVD HISGVLTFDT DVFSSAKALH PGSAAGSAES       540
     EVGSVQRLQN TPAEIARLQL TRLAKTLHVT CMYVDPSYNE ARLQAKRAAL ARAEAGAAKE       600
     HEETLARRVI IEKKKEAATD ALQRKQREEE TRKRIRTQQL QEAEKQRLLD EHREREKKRI       660
     KDEQDRIRQQ ELKKQLEELK TGVKGIDISE LDLNELDANR LRAMKLAQLE KEKNELNDRI       720
     RTTAKRIDHL ERAFRREELK HVPEDYEKQK QRDMEIYEAT KAEALKEAED KHKEAVALKH       780
     RLSRLVPQFN SFRKEVSEKR HEEFEKRRKA AERDFEAKKM QRIKEVQERR RRERAEREEE       840
     ERRRKEEEER IRREEEERTA KEEERRRVLA EEKAKREEER KRLDELAAKQ KQREEEAEAR       900
     RAARRTGGAE PEAAPERAAP TERTAPRLNL APRTGGAGPS WRERQAAKEA AGGTPAAPAA       960
     AAPEPAREEP APVRRTGGYV PPHLRSGASA TPAAPAPAPS TERYVPRAMR EAGSSQPPSR      1020
     TQTPGSSSDK PEESKPAAGK WVPRWKQQQG GQ                                    1052
//

If you have problems or comments...

PBIL Back to PBIL home page