(data stored in ACNUC7421 zone)

EMBL: AM269962.PE3

AM269962.PE3         Location/Qualifiers
FT   CDS             complement(join(5951..6341,6403..7071,7133..7518))
FT                   /locus_tag="An01g04230"
FT                   /note="Title: strong similarity to hypothetical WD-repeat
FT                   transcription regulation protein SPCC18.13
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8G2"
FT                   /db_xref="InterPro:IPR028884"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G2"
FT                   /inference="similar to AA sequence:PIR:T41156"
FT                   /protein_id="CAK36959.1"
FT                   /translation="MSAHFQHPLQCLRLVQRSTANLLIGSAGSKLYSYSAETGQRLAVW
FT                   PEDVASSETKPVDAESAPEQGPPEKKRKVSSSDSPTIEKPAWSNIPIVTGTASGEHIIA
FT                   LTAEDKCVRVFQLQEDGSFVQLSQRVMPKRPSAITLTDDDDTILCGDKFGDVYSLPLIP
FT                   SDKLPAITKSLRSAKLSHPAATNLTVHTKGNRRALEQQLRLASEGKRDEKSSGPTFEHK
FT                   ILLGHVSLLTDMAYVSLPVDENKKRSYILTADRDEHIRVSRGPPQAHVIENYCLGHTAF
FT                   ISKLCVPQWAPQYLVSGGGDNYLLVWKWAEGRILQKVSLVDEASESTEVAVQGIWATSL
FT                   GNLRIILVALHGSSRLQCFTLESDGSLKTQASIQLSGNVLDLTPVEKDNTILVSVDSIR
FT                   QPDSTQEWRTSPSSPSTLIEAFHIKSGTDSLEWEPTAASVTDKINSTGTEEVPATTEEK
FT                   QRKELNDSLYGLGHLRKRKGEDE"
     MSAHFQHPLQ CLRLVQRSTA NLLIGSAGSK LYSYSAETGQ RLAVWPEDVA SSETKPVDAE        60
     SAPEQGPPEK KRKVSSSDSP TIEKPAWSNI PIVTGTASGE HIIALTAEDK CVRVFQLQED       120
     GSFVQLSQRV MPKRPSAITL TDDDDTILCG DKFGDVYSLP LIPSDKLPAI TKSLRSAKLS       180
     HPAATNLTVH TKGNRRALEQ QLRLASEGKR DEKSSGPTFE HKILLGHVSL LTDMAYVSLP       240
     VDENKKRSYI LTADRDEHIR VSRGPPQAHV IENYCLGHTA FISKLCVPQW APQYLVSGGG       300
     DNYLLVWKWA EGRILQKVSL VDEASESTEV AVQGIWATSL GNLRIILVAL HGSSRLQCFT       360
     LESDGSLKTQ ASIQLSGNVL DLTPVEKDNT ILVSVDSIRQ PDSTQEWRTS PSSPSTLIEA       420
     FHIKSGTDSL EWEPTAASVT DKINSTGTEE VPATTEEKQR KELNDSLYGL GHLRKRKGED       480
     E                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page