(data stored in ACNUC7421 zone)

EMBL: AM269962.PE4

AM269962.PE4         Location/Qualifiers
FT   CDS             join(7854..8027,8085..8154,8219..8913)
FT                   /locus_tag="An01g04240"
FT                   /note="Remark: P0 of S. cerevisiae belongs to the family of
FT                   rat acidic ribosomal proteins P0."
FT                   /note="Remark: P0 of S. cerevisiae is also called A0,L8300.
FT                   8, YLR340w and ribosomal protein YL10e."
FT                   /note="Similarity: the ORF overlaps with the EST seq id
FT                   NO:3822 of patent WO200056762-A2 from A. niger."
FT                   /note="Title: strong similarity to cytoplasmic acidic
FT                   ribosomal protein P0 - Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 2681177"
FT                   /note="See PMID 3287327"
FT                   /db_xref="GOA:A2Q8G3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR030670"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G3"
FT                   /inference="profile:COGS:COG0244"
FT                   /inference="profile:PFAM:PF00428"
FT                   /inference="profile:PFAM:PF00466"
FT                   /inference="similar to AA sequence:PIR:R5BY0E"
FT                   /protein_id="CAK36960.1"
FT                   /translation="MGGKSATKAAYFEKLKALLDEYKTVFIVGVDNVSSQQMHEIRLSL
FT                   RGEGVVLMGKNTMVRRAIKGFVNDNPEYERLLPFVKGNVGFIFTNGDLKATKEKILANR
FT                   VAAPARAGAIAPGDVWVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGS
FT                   KVGPSEATLLNMLNISPFTYGMTIQQVYDQGQCFSSAVLDIEESQLLEAFSSAINTITT
FT                   ISLAVSYPTIPAVMHSLVNSYKKVLAVAVETEYSWPEIEELKDRIANPDAYASAAPAAA
FT                   AAPAAGGAPAAEAPKEEEEESDEDMGFGLFD"
     MGGKSATKAA YFEKLKALLD EYKTVFIVGV DNVSSQQMHE IRLSLRGEGV VLMGKNTMVR        60
     RAIKGFVNDN PEYERLLPFV KGNVGFIFTN GDLKATKEKI LANRVAAPAR AGAIAPGDVW       120
     VPAGNTGMEP GKTSFFQALG VPTKIARGTI EITTDLKLVE AGSKVGPSEA TLLNMLNISP       180
     FTYGMTIQQV YDQGQCFSSA VLDIEESQLL EAFSSAINTI TTISLAVSYP TIPAVMHSLV       240
     NSYKKVLAVA VETEYSWPEI EELKDRIANP DAYASAAPAA AAAPAAGGAP AAEAPKEEEE       300
     ESDEDMGFGL FD                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page