(data stored in ACNUC7421 zone)

EMBL: AM269962.PE5

AM269962.PE5         Location/Qualifiers
FT   CDS             join(9732..9786,9842..9883,9982..10905,10955..11025)
FT                   /locus_tag="An01g04250"
FT                   /EC_number="4.1.1.37"
FT                   /note="Catalytic activity: Uroporphyrinogen-III <=>
FT                   coproporphyrinogen + 4 CO(2)."
FT                   /note="Function: the T. terrestris homolog catalyzes the
FT                   sequential decarboxylation of the four acetyl side chains
FT                   of uroporphyrinogen to yield coproporphyrinogen, an
FT                   intermediate in protoheme biosynthesis."
FT                   /note="Title: strong similarity to uroporphyrinogen
FT                   decarboxylase from patent WO9925839-A1 - Thielavia
FT                   terrestris"
FT                   /note="cytoplasm"
FT                   /db_xref="GOA:A2Q8G4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G4"
FT                   /inference="profile:COGS:COG0407"
FT                   /inference="profile:PFAM:PF01208"
FT                   /protein_id="CAK36961.1"
FT                   /translation="MQHQFEPLKNDLLLRAARGEKVQRPPIWVMRQAGRYLPEYHEAKA
FT                   GRDFFECCRDPEVASTLTIQPIDRYAGLIDAAIIFSDILVIPQAMGMQVEMVDKKGPHF
FT                   PEPLQSPDDGQYEKVMQKDVDVKSELDYVYKAITLTRHKLQGRVPLIGFCGAPWTLLCY
FT                   MVEGGGTKLFVQSKKWIYKYPKESQALLQKIAEICVEYLALQVAAGAQLVQVFDSWAGE
FT                   LSPAAFKSFSLPYLRHISANLPKKLKEMGLEPVPMTVFAKGAWFGLEDLCESGYNVVGL
FT                   DWLHDPAEARRIANGRVTIQGNADPGVLYGGREAITEAVETMVRGFEKGKQGWIANLGH
FT                   GVTPFVNPDDLKFFFEEIHRLTV"
     MQHQFEPLKN DLLLRAARGE KVQRPPIWVM RQAGRYLPEY HEAKAGRDFF ECCRDPEVAS        60
     TLTIQPIDRY AGLIDAAIIF SDILVIPQAM GMQVEMVDKK GPHFPEPLQS PDDGQYEKVM       120
     QKDVDVKSEL DYVYKAITLT RHKLQGRVPL IGFCGAPWTL LCYMVEGGGT KLFVQSKKWI       180
     YKYPKESQAL LQKIAEICVE YLALQVAAGA QLVQVFDSWA GELSPAAFKS FSLPYLRHIS       240
     ANLPKKLKEM GLEPVPMTVF AKGAWFGLED LCESGYNVVG LDWLHDPAEA RRIANGRVTI       300
     QGNADPGVLY GGREAITEAV ETMVRGFEKG KQGWIANLGH GVTPFVNPDD LKFFFEEIHR       360
     LTV                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page