(data stored in ACNUC7421 zone)

EMBL: AM269962.PE6

AM269962.PE6         Location/Qualifiers
FT   CDS             complement(join(11125..11146,11224..11489,11559..11717))
FT                   /locus_tag="An01g04260"
FT                   /EC_number="3.5.4.1"
FT                   /note="Catalytic activity: cytosine + H(2)O <=> uracil +
FT                   NH(3)."
FT                   /note="Remark: strong similarity to cytosine deaminase FCA1
FT                   - Candida albicans."
FT                   /note="Title: strong similarity to cytosine deaminase FCA1
FT                   - Candida albicans"
FT                   /note="See PMID 9000374"
FT                   /db_xref="GOA:A2Q8G5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G5"
FT                   /inference="profile:COGS:COG0590"
FT                   /inference="profile:PFAM:PF00383"
FT                   /inference="similar to AA sequence:SWISSPROT:FCA1.CANAL"
FT                   /protein_id="CAK36962.1"
FT                   /translation="METDPGFIAAVEEAKQGAAEGGVPIGACLVSKDGKILGRGHNMRV
FT                   QKGSPVLHAEMSALENSGRLPASAYEGATMYTTLSPCDMCTGACILYKVKRVVVGENKS
FT                   FMGGEDYLKSRGKEVVVLDNAECKQLMEKFMKEKPELWNEDISV"
     METDPGFIAA VEEAKQGAAE GGVPIGACLV SKDGKILGRG HNMRVQKGSP VLHAEMSALE        60
     NSGRLPASAY EGATMYTTLS PCDMCTGACI LYKVKRVVVG ENKSFMGGED YLKSRGKEVV       120
     VLDNAECKQL MEKFMKEKPE LWNEDISV                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page