(data stored in ACNUC7421 zone)

EMBL: AM269962.PE8

AM269962.PE8         Location/Qualifiers
FT   CDS             join(13887..13922,13992..14061,14139..14957,15018..15334)
FT                   /locus_tag="An01g04280"
FT                   /note="Function: Haploid S. cerevisiae cells carrying the
FT                   disrupted YDJ1 gene are inviable for growth in liquid
FT                   media."
FT                   /note="Function: YDJ1p from S. cerevisiae is involved
FT                   mitochondrial and ER import."
FT                   /note="Function: YDJ1p from S. cerevisiae is required for
FT                   normal growth and disruption of its gene results in very
FT                   slow growing cells that have pleiotropic morphological
FT                   defects."
FT                   /note="Localization: YDJ1p from S. cerevisiae
FT                   cofractionates with nuclei and also microsomes, suggesting
FT                   that its perinuclear localization reflects association with
FT                   the ER."
FT                   /note="Remark: has similarity to family of dnaJ heat shock
FT                   proteins."
FT                   /note="Remark: synonyms for Ydj1 from S. cerevisiae are
FT                   Mas5 and YNL064c."
FT                   /note="Similarity: the ORF also shows strong similarity to
FT                   expressed sequence tag seq id no:6895 of patent
FT                   WO200056762-A2 from Aspergillus oryzae."
FT                   /note="Title: strong similarity to dnaJ protein homolog
FT                   Ydj1 - Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 11014801"
FT                   /note="See PMID 11689685"
FT                   /db_xref="GOA:A2Q8G7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G7"
FT                   /inference="profile:COGS:COG0484"
FT                   /inference="profile:PFAM:PF00226"
FT                   /inference="profile:PFAM:PF00684"
FT                   /inference="profile:PFAM:PF01556"
FT                   /inference="similar to AA sequence:PIR:S26703"
FT                   /protein_id="CAK36964.1"
FT                   /translation="MVKETKFYDILGVPPTASEAQLKTAYKKGALKYHPDKNTNNPEAA
FT                   EKFKELSAAYETLSDPQKRSLYDQLGEEGLEHGGAGGGMGAEDLFAQFFGGGGGFGGMF
FT                   GGGMRDQGPKKARTIHHVHKVNLEDIYRGKVSKLALQKSVICPGCDGRGGKEGAVKSCT
FT                   GCNGSGMKTMMRQMGPMIQRFQTVCPDCNGEGEIIREKDRCKRCNGKKTTVERKVLHVH
FT                   VDRGVKNGHKIEFRGEGDQMPGVLPGDVVFEIEQKPHPRFQRKDDDLFYQAEIDLLTAL
FT                   GGGTINIEHLDDRWLTVTVAPGEVITPGAIKVIKGQGMPSYRHHDFGNLYIQFDVKFPE
FT                   KDQLKNLELLEQVLPPRMEQSQPPQDAMIEDFELEDIDGSESSQARAHGAASAMDEDDE
FT                   DVPPGAERVQCASQ"
     MVKETKFYDI LGVPPTASEA QLKTAYKKGA LKYHPDKNTN NPEAAEKFKE LSAAYETLSD        60
     PQKRSLYDQL GEEGLEHGGA GGGMGAEDLF AQFFGGGGGF GGMFGGGMRD QGPKKARTIH       120
     HVHKVNLEDI YRGKVSKLAL QKSVICPGCD GRGGKEGAVK SCTGCNGSGM KTMMRQMGPM       180
     IQRFQTVCPD CNGEGEIIRE KDRCKRCNGK KTTVERKVLH VHVDRGVKNG HKIEFRGEGD       240
     QMPGVLPGDV VFEIEQKPHP RFQRKDDDLF YQAEIDLLTA LGGGTINIEH LDDRWLTVTV       300
     APGEVITPGA IKVIKGQGMP SYRHHDFGNL YIQFDVKFPE KDQLKNLELL EQVLPPRMEQ       360
     SQPPQDAMIE DFELEDIDGS ESSQARAHGA ASAMDEDDED VPPGAERVQC ASQ              413
//

If you have problems or comments...

PBIL Back to PBIL home page