(data stored in ACNUC7421 zone)

EMBL: AM269962.PE9

AM269962.PE9         Location/Qualifiers
FT   CDS             complement(join(16711..17442,17502..19294,19357..19435))
FT                   /locus_tag="An01g04300"
FT                   /note="Title: strong similarity to protein fragment SEQ ID
FT                   NO:54638 from patent EP1033405-A2 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8G8"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G8"
FT                   /inference="profile:PFAM:PF04100"
FT                   /protein_id="CAK36965.1"
FT                   /translation="MSATTTTTTPGQMPSNGEVPLDPLDAADYDPIDHLNAIFSHPSTL
FT                   SSVSQVSQSLREYEDELDNDIGALVEDQVTSNAESVERIQAAKADLTELFKKIDDVRDR
FT                   ASRTELAITEMTADIKQLDNAKKNLTLSMTVLKRLQMLTTAYDQLRSLGRTRQYRDCAQ
FT                   LLQAVIQLMAHFKSYRSIDQIALLSRNVADIQRELLEQVCEDFELAFAKGEVGQKRHVL
FT                   SEGCLVMDALGDHAKSRLVTWYCNFQLREYRQVFRNNEEAGSLDNISRRYAWFRRILKN
FT                   YDEEYAPIFPASWRVNEILANIFCEGTREDFKGILSRSVRNGQTIDVNLLLSCLQETLD
FT                   FEHSLERRFVSPSRPSTDTFASSEAPVFGQAISEAFEPYLSVWVEAQDKQLAALIPKYR
FT                   QQPAKPPDEEFDSHIVISSSTDLFTFYRHSLQQCAKLSTGASLAELAKVFAKYLDQYAQ
FT                   VLLYYISERPTGHTPSKVPGTEDLILVLNTADYCYTTCNQLEEKIKGRLDKNLKQSVDL
FT                   QSQADSFMGIASAAVRGLVRKVEIDLEPCWREMRNTPWNRLEGVSDQSSYVGELMSKTQ
FT                   TRCSELLQLLHKQQYARAFADHVVELISNVFIATIFQCKPVAETGAEQMLLDAYTLKTG
FT                   LSSLLPSPAPAGFVKRVNASFAKIEALLKTLQVQPSPPEALVQAYLVHIADQNNANFRK
FT                   ILDLKGIRSRQDQNHLIELFQIHRASDRYAANLQQSNPILTAMQASATPSSGTVSQGLG
FT                   LGTAAASIGASTRFDPTMLGSAIISAAKDGVDRFGTPMSSANTTNLTPGGSAISGALTS
FT                   PASTPGPLGQAQPQGGESTTAAGNLNENLKNIGKFFRRDLGGFGGRFGRSGDDGN"
     MSATTTTTTP GQMPSNGEVP LDPLDAADYD PIDHLNAIFS HPSTLSSVSQ VSQSLREYED        60
     ELDNDIGALV EDQVTSNAES VERIQAAKAD LTELFKKIDD VRDRASRTEL AITEMTADIK       120
     QLDNAKKNLT LSMTVLKRLQ MLTTAYDQLR SLGRTRQYRD CAQLLQAVIQ LMAHFKSYRS       180
     IDQIALLSRN VADIQRELLE QVCEDFELAF AKGEVGQKRH VLSEGCLVMD ALGDHAKSRL       240
     VTWYCNFQLR EYRQVFRNNE EAGSLDNISR RYAWFRRILK NYDEEYAPIF PASWRVNEIL       300
     ANIFCEGTRE DFKGILSRSV RNGQTIDVNL LLSCLQETLD FEHSLERRFV SPSRPSTDTF       360
     ASSEAPVFGQ AISEAFEPYL SVWVEAQDKQ LAALIPKYRQ QPAKPPDEEF DSHIVISSST       420
     DLFTFYRHSL QQCAKLSTGA SLAELAKVFA KYLDQYAQVL LYYISERPTG HTPSKVPGTE       480
     DLILVLNTAD YCYTTCNQLE EKIKGRLDKN LKQSVDLQSQ ADSFMGIASA AVRGLVRKVE       540
     IDLEPCWREM RNTPWNRLEG VSDQSSYVGE LMSKTQTRCS ELLQLLHKQQ YARAFADHVV       600
     ELISNVFIAT IFQCKPVAET GAEQMLLDAY TLKTGLSSLL PSPAPAGFVK RVNASFAKIE       660
     ALLKTLQVQP SPPEALVQAY LVHIADQNNA NFRKILDLKG IRSRQDQNHL IELFQIHRAS       720
     DRYAANLQQS NPILTAMQAS ATPSSGTVSQ GLGLGTAAAS IGASTRFDPT MLGSAIISAA       780
     KDGVDRFGTP MSSANTTNLT PGGSAISGAL TSPASTPGPL GQAQPQGGES TTAAGNLNEN       840
     LKNIGKFFRR DLGGFGGRFG RSGDDGN                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page