(data stored in ACNUC7421 zone)

EMBL: AM269963.PE1

AM269963.PE1         Location/Qualifiers
FT   CDS             join(1247..1318,1450..1519,1607..1678,1768..1979)
FT                   /locus_tag="An01g04440"
FT                   /note="Similarity: the C-terminal region of the predicted
FT                   protein shows no similarity."
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein SMc00345 - Sinorhizobium meliloti"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I2"
FT                   /inference="profile:COGS:COG3526"
FT                   /inference="profile:PFAM:PF05169"
FT                   /inference="similar to AA sequence:UniProtKB:SME591783.36"
FT                   /protein_id="CAK36979.1"
FT                   /translation="MHNHLPRITIKYCTQCKWLLRAAYFAQELLSTFSTQLGEVALVPA
FT                   TGGTGGEDVDITGTILWDRKTNGGFPEVKVLKSLVRNVVDPSRDLGHTDRALRAANVPV
FT                   QSRDGDEKVVGKSQEQESTTAAAATATKGEEKCEECQ"
     MHNHLPRITI KYCTQCKWLL RAAYFAQELL STFSTQLGEV ALVPATGGTG GEDVDITGTI        60
     LWDRKTNGGF PEVKVLKSLV RNVVDPSRDL GHTDRALRAA NVPVQSRDGD EKVVGKSQEQ       120
     ESTTAAAATA TKGEEKCEEC Q                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page