(data stored in ACNUC7421 zone)

EMBL: AM269963.PE10

AM269963.PE10        Location/Qualifiers
FT   CDS             join(24681..25316,25395..25484,25541..25723,25780..26260,
FT                   26311..26482,26534..26695,26749..27195,27251..27692,
FT                   27728..27856)
FT                   /locus_tag="An01g04520"
FT                   /note="Function: D. melanogaster mus308 encodes a theta DNA
FT                   polymerase involved in DNA repair."
FT                   /note="Function: mus308 is required in D. melanogaster to
FT                   process ethyl nitrosourea (ENU) induced lesions, and may
FT                   play a role in post replication bypass of
FT                   O-alkylpyrimidines, probably mediated by
FT                   recombination,which serves to increase the time available
FT                   for error-free repair of these lesions."
FT                   /note="Similarity: mus308 of D. melanogaster and other
FT                   similar proteins are twice longer than the predicted
FT                   proetin."
FT                   /note="Title: similarity to theta DNA polymerase mus308
FT                   -Drosophila melanogaster"
FT                   /note="See PMID 8417992"
FT                   /note="See PMID 8816490"
FT                   /note="See PMID 9539982"
FT                   /note="See PMID 10343651"
FT                   /note="See PMID 10732683"
FT                   /db_xref="GOA:A2Q8J1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J1"
FT                   /inference="profile:COGS:COG1204"
FT                   /inference="profile:PFAM:PF00270"
FT                   /inference="similar to AA sequence:PIR:T13858"
FT                   /protein_id="CAK36988.1"
FT                   /translation="MSAPPGQPFQTYGFQTSVDIARQRTFEVVPLAGNKRPPDPSADDD
FT                   HRPVGVKHPTTAPGAVGRSVDFIRPSFILPKARLVASDIYPVAETPPVCRGQQPNVFPT
FT                   DHDPAHNPYLSLNHPTYGLPPGLVANFAAAGLSSIYQWQASCLLAPGLLKGDRHLVYTA
FT                   PTGGGKSLVADVLMLKRIIENPGRKAILVLPYVALVQEKLKWLRRIVQDRSIRVTGYYG
FT                   GSRTAASWADTDIAVCTIEKANSLINSAIEECSIGDLGVVVLDELHMLDDEHRGYLLEL
FT                   MVTKLLLLRQRTQIIGMSATLSNTEMLAEWMNAAYFVSTYRPIPIDDYLVYENAIYPAA
FT                   TSRQLFQTISKLKSMSNATLMERMPPDRVIRPSTFRELANPMTNATVALAIDTAGAGHG
FT                   ALVFCGSRHMCQIQAVVMSEAMPAPADNTDELTKRLDLLAELRSLPSGLDPVLEKTLVR
FT                   GVGFHHAGMTAEERELIAQAYDQGVLRTLIATCSLAAGVNLPARRVIINGARMGRELVG
FT                   PAMLRQMCGRAGRKGKDDAGETYLICGDSDLQAVCDLLEAEMPAIESCLAPEKRGLKRA
FT                   LLEAIATGLVSGNDAIKEYVRCTLLYLTVDKKVAYAIMGSALQELATEGLVQLNDDESY
FT                   SSTQLGQAVVASAFAPEDGLFVFEELKRALQAFVMDGDMHIFYLFTPLQAATATPIDWL
FT                   IFRDQLDNLDESGLRALQFVGVSPGFVNTMAQSGASLKENTPEQMNQARIYRRAYTAFQ
FT                   LRDLSNEMPLSAVANRYRIPRGAVQTLAQQCHGFAAGIVKFCQRMNWGMLAAVLDHMRD
FT                   RLEAGARADLLEMAQVTYVKGWTARLLRENGFRNLRALAEADAKDLVPILMMVWQTLMA
FT                   VNPRKTQKNQLHPAEAERYAKKLLAKAEVIVASANKIWGTYG"
     MSAPPGQPFQ TYGFQTSVDI ARQRTFEVVP LAGNKRPPDP SADDDHRPVG VKHPTTAPGA        60
     VGRSVDFIRP SFILPKARLV ASDIYPVAET PPVCRGQQPN VFPTDHDPAH NPYLSLNHPT       120
     YGLPPGLVAN FAAAGLSSIY QWQASCLLAP GLLKGDRHLV YTAPTGGGKS LVADVLMLKR       180
     IIENPGRKAI LVLPYVALVQ EKLKWLRRIV QDRSIRVTGY YGGSRTAASW ADTDIAVCTI       240
     EKANSLINSA IEECSIGDLG VVVLDELHML DDEHRGYLLE LMVTKLLLLR QRTQIIGMSA       300
     TLSNTEMLAE WMNAAYFVST YRPIPIDDYL VYENAIYPAA TSRQLFQTIS KLKSMSNATL       360
     MERMPPDRVI RPSTFRELAN PMTNATVALA IDTAGAGHGA LVFCGSRHMC QIQAVVMSEA       420
     MPAPADNTDE LTKRLDLLAE LRSLPSGLDP VLEKTLVRGV GFHHAGMTAE ERELIAQAYD       480
     QGVLRTLIAT CSLAAGVNLP ARRVIINGAR MGRELVGPAM LRQMCGRAGR KGKDDAGETY       540
     LICGDSDLQA VCDLLEAEMP AIESCLAPEK RGLKRALLEA IATGLVSGND AIKEYVRCTL       600
     LYLTVDKKVA YAIMGSALQE LATEGLVQLN DDESYSSTQL GQAVVASAFA PEDGLFVFEE       660
     LKRALQAFVM DGDMHIFYLF TPLQAATATP IDWLIFRDQL DNLDESGLRA LQFVGVSPGF       720
     VNTMAQSGAS LKENTPEQMN QARIYRRAYT AFQLRDLSNE MPLSAVANRY RIPRGAVQTL       780
     AQQCHGFAAG IVKFCQRMNW GMLAAVLDHM RDRLEAGARA DLLEMAQVTY VKGWTARLLR       840
     ENGFRNLRAL AEADAKDLVP ILMMVWQTLM AVNPRKTQKN QLHPAEAERY AKKLLAKAEV       900
     IVASANKIWG TYG                                                          913
//

If you have problems or comments...

PBIL Back to PBIL home page