(data stored in ACNUC7421 zone)

EMBL: AM269963.PE11

AM269963.PE11        Location/Qualifiers
FT   CDS             complement(join(28221..28582,28638..29184))
FT                   /locus_tag="An01g04530"
FT                   /note="Similarity: strong similarity to A. niger EST
FT                   EMBLEST:BE760850."
FT                   /note="Similarity: the predicted ORF does not contain
FT                   structural features common to protein kinases."
FT                   /note="Title: similarity to hypothetical MAP3K protein
FT                   kinase-like protein MLD14.3 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8J2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J2"
FT                   /protein_id="CAK36989.1"
FT                   /translation="MMFPPSILFGLAVGIASIVPTIAQSTCNGQAEYCDRRFSNVTQVG
FT                   AHDSPFVGSLLSDNQDLSVTQQLDLGIRFLQGQTHKSELDDTILLCHTSCLLEDAGSLE
FT                   SFLTTVKTWMDSNPDEVVTLLLTNGDSLSVSQFGDVFNSSGISDYAFVPSSSPDTLAMD
FT                   EWPTLRELIGNGTRLVSFLDYGADASTVPYILDEFAYFFETPYDVTNATFPDCSIDRPA
FT                   GASASGRMYIVNHFLDVDILGILIPDKDHASDTNAVSGSGSIGAQADLCYSIYDRLPNF
FT                   ILLDFVDLGEPIAAQSELNGV"
     MMFPPSILFG LAVGIASIVP TIAQSTCNGQ AEYCDRRFSN VTQVGAHDSP FVGSLLSDNQ        60
     DLSVTQQLDL GIRFLQGQTH KSELDDTILL CHTSCLLEDA GSLESFLTTV KTWMDSNPDE       120
     VVTLLLTNGD SLSVSQFGDV FNSSGISDYA FVPSSSPDTL AMDEWPTLRE LIGNGTRLVS       180
     FLDYGADAST VPYILDEFAY FFETPYDVTN ATFPDCSIDR PAGASASGRM YIVNHFLDVD       240
     ILGILIPDKD HASDTNAVSG SGSIGAQADL CYSIYDRLPN FILLDFVDLG EPIAAQSELN       300
     GV                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page