(data stored in ACNUC7421 zone)

EMBL: AM269963.PE12

AM269963.PE12        Location/Qualifiers
FT   CDS             join(30044..30231,30527..30859,30916..31315)
FT                   /locus_tag="An01g04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8J3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J3"
FT                   /protein_id="CAK36990.1"
FT                   /translation="MDKESPMLTSAFATFDSSATESIPAINLRNIKYWEIGRCDVSAEL
FT                   MNWMSLPKPSTWNSINRVYQEYQEYQLLLRRWVSPVSLPGRSFSIASSSPVQSKLVAAS
FT                   SPSLDPFLTPFGIISSLPEQLVRLLAVLSPSVCRRPEPDIQPPVDPGQPPLLLPHSSFV
FT                   TSIVETTSASPWSDGHSNIPPMSSMIETSNDWAREDELDLGQEDDEHSPPARNGVSDHV
FT                   NTQEPPDHGPMAYFEEDLPGVASENHVSGKPSPPVDADSTDLPSSPQSGQPGAPGSVDE
FT                   TLSTPDDTPSLHVGRDYVCSALTPR"
     MDKESPMLTS AFATFDSSAT ESIPAINLRN IKYWEIGRCD VSAELMNWMS LPKPSTWNSI        60
     NRVYQEYQEY QLLLRRWVSP VSLPGRSFSI ASSSPVQSKL VAASSPSLDP FLTPFGIISS       120
     LPEQLVRLLA VLSPSVCRRP EPDIQPPVDP GQPPLLLPHS SFVTSIVETT SASPWSDGHS       180
     NIPPMSSMIE TSNDWAREDE LDLGQEDDEH SPPARNGVSD HVNTQEPPDH GPMAYFEEDL       240
     PGVASENHVS GKPSPPVDAD STDLPSSPQS GQPGAPGSVD ETLSTPDDTP SLHVGRDYVC       300
     SALTPR                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page