(data stored in ACNUC7421 zone)

EMBL: AM269963.PE15

AM269963.PE15        Location/Qualifiers
FT   CDS             complement(join(38801..40376,40426..40856,40903..41049,
FT                   41105..41518,41575..41897,41953..42011,42091..42134))
FT                   /locus_tag="An01g04570"
FT                   /note="Function: CAP10 of C. neoformans is a cytoplasmic
FT                   protein required for capsule formation."
FT                   /note="Remark: C. neoformans is a pathogenic fungus which
FT                   most commonly affects the central nervous system and causes
FT                   fatal meningoencephalitis primarily in patients with
FT                   AIDS,and produces a thick extracellular polysaccharide
FT                   capsule which is well recognized as a virulence factor."
FT                   /note="Title: strong similarity to capsular associated
FT                   protein CAP10 - Filobasidiella neoformans"
FT                   /note="cytoplasm"
FT                   /note="See PMID 10482503"
FT                   /db_xref="GOA:A2Q8J6"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J6"
FT                   /inference="similar to AA sequence:UniProtKB:AF144574.1"
FT                   /protein_id="CAK36993.1"
FT                   /translation="MVFLSAETGLKAAVGVFLLSCTFISTSYKTTFAFDHPLITAVLAC
FT                   YFAGICLLILSRFIHRIPKIASSAPKYSAIPLTERDQTLEEPFSPISLDSNSSFALTRS
FT                   RSSARWIKLGLLSVLGCIRIALYRDLTFHTECAPDGYAYSIPFLLALYDYWRNQRNRPV
FT                   AKWSAPERPQNAHLRAVATFASRMHNFLFQSRLRYVIAAFFLLTGGYITITFSHGLQST
FT                   YICPNTSSVYTRMRVFTIFSLILDSLILIGAAELASEGSRSGDTIRKPPLASWAYSLLG
FT                   VAIFYTIVVIILVATSDGDDRFISAQYLRSAVGQAVLVTCVVAAASQLIPYYGIAGLAV
FT                   LAGFVTLYFTWASTLFNGQHPFPLIFASRAFAALFFIFAGAVAFLYARTASEDEAQFLY
FT                   RFNLAMRITFAFLTVIGLVLVHQQHSAAHLHPIDLLVYDGRQHHDQWLARANSSQTLTD
FT                   AVRKYRAQYNQHPPPNFDKWYEYAVNRSSLVIDEFDQIYADLLPFRALPPAQIRDMTQK
FT                   LATNPYNEIGAISIRNGKARVQEGIKPTHAWMVISASKMIEKFAEFLPDMDLAFNLNDE
FT                   PRVSVPWEKVSVLRHQARSYGLPPEDSIQTEWSTDRGAQWGPIEPADQTTETMFVDNSF
FT                   KHIFDRYVSSTCPRSSKARSQRIWDRRHICLSCVRPHSLGEFPSDWTAATDICHQPDLA
FT                   SLHGFFLSPASFKVTQDLTPVFSQSTIAGFNDIIFPSPWNYVDKIEYKPSEEHPDANYT
FT                   DKTNTLFWIGSTSEGVSNHGEWKGIPRQRLAHLVNNNTLNSVSVFLPTNETDTYMYEVL
FT                   NGRAPSDILHLDTSVNVIDPIVRCRREDCDDQSKELGAASRVDFQSHWQYRYLFDSDGA
FT                   GFSGRFLPFMQSHSLPFKTGLFRQWFDSRITPWLHFVPIDLRLHGLWSTLAYFAGVDTT
FT                   LTVNGATRHVHMPPHDIEGTWIAEEGRKWANRVIRKEDMEIYFFRLLLEWGRITDDQRD
FT                   VLGYRLDM"
     MVFLSAETGL KAAVGVFLLS CTFISTSYKT TFAFDHPLIT AVLACYFAGI CLLILSRFIH        60
     RIPKIASSAP KYSAIPLTER DQTLEEPFSP ISLDSNSSFA LTRSRSSARW IKLGLLSVLG       120
     CIRIALYRDL TFHTECAPDG YAYSIPFLLA LYDYWRNQRN RPVAKWSAPE RPQNAHLRAV       180
     ATFASRMHNF LFQSRLRYVI AAFFLLTGGY ITITFSHGLQ STYICPNTSS VYTRMRVFTI       240
     FSLILDSLIL IGAAELASEG SRSGDTIRKP PLASWAYSLL GVAIFYTIVV IILVATSDGD       300
     DRFISAQYLR SAVGQAVLVT CVVAAASQLI PYYGIAGLAV LAGFVTLYFT WASTLFNGQH       360
     PFPLIFASRA FAALFFIFAG AVAFLYARTA SEDEAQFLYR FNLAMRITFA FLTVIGLVLV       420
     HQQHSAAHLH PIDLLVYDGR QHHDQWLARA NSSQTLTDAV RKYRAQYNQH PPPNFDKWYE       480
     YAVNRSSLVI DEFDQIYADL LPFRALPPAQ IRDMTQKLAT NPYNEIGAIS IRNGKARVQE       540
     GIKPTHAWMV ISASKMIEKF AEFLPDMDLA FNLNDEPRVS VPWEKVSVLR HQARSYGLPP       600
     EDSIQTEWST DRGAQWGPIE PADQTTETMF VDNSFKHIFD RYVSSTCPRS SKARSQRIWD       660
     RRHICLSCVR PHSLGEFPSD WTAATDICHQ PDLASLHGFF LSPASFKVTQ DLTPVFSQST       720
     IAGFNDIIFP SPWNYVDKIE YKPSEEHPDA NYTDKTNTLF WIGSTSEGVS NHGEWKGIPR       780
     QRLAHLVNNN TLNSVSVFLP TNETDTYMYE VLNGRAPSDI LHLDTSVNVI DPIVRCRRED       840
     CDDQSKELGA ASRVDFQSHW QYRYLFDSDG AGFSGRFLPF MQSHSLPFKT GLFRQWFDSR       900
     ITPWLHFVPI DLRLHGLWST LAYFAGVDTT LTVNGATRHV HMPPHDIEGT WIAEEGRKWA       960
     NRVIRKEDME IYFFRLLLEW GRITDDQRDV LGYRLDM                                997
//

If you have problems or comments...

PBIL Back to PBIL home page