(data stored in ACNUC7421 zone)

EMBL: AM269963.PE18

AM269963.PE18        Location/Qualifiers
FT   CDS             49654..51201
FT                   /locus_tag="An01g04610"
FT                   /note="Title: similarity to hypothetical protein CAE76271.1
FT                   - Neurospora crassa"
FT                   /db_xref="GOA:A2Q8J9"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J9"
FT                   /inference="profile:PFAM:PF00646"
FT                   /protein_id="CAK36996.1"
FT                   /translation="MSIASPSEGKGMALLPREIFWLVLKHLEPGDVLRCRRVCQSWNVA
FT                   FRIGANLLPMLKKRYPLAREVRQLDSESAESLETPEYDVRISQIFDKVTAKYDYLSRVT
FT                   PQTMHRLKLCDDFGITGERNWFPVQPWEYHASHLMQRIDRPFGETFWSYDDGLLVYPSA
FT                   DHSCLVLMDMETDRKFMVPFMIVGRVIRRVRLQKRVLVIEWAENKAYHWLNDSDGVHRH
FT                   FATSFDVNQKEDGWRVNFRNEWKIMFLGHPLSERDRFYSTHTQTHYAIYIWQPNRSLYT
FT                   ADEDAPIESLSVWDISKPSDYRPSLDPTGRLRVESGGGEEDLGPTIITRFGFRELGFYG
FT                   VRQRGLPAIQSLNITDDDQSIEILEGTCAGRSPQVLVPDEWESEVWVTTIPIVGEGPCR
FT                   RRRADFPLPPYRGNCSLQTNPITFAICDEPWYSIVCESYDEQSQVGYCLYLEEQIWPVE
FT                   TAMFLAVGSPEYAPEPANVLPESLVMELTAMGKVCGTEDYLIGQSHNRELVIFRFDR"
     MSIASPSEGK GMALLPREIF WLVLKHLEPG DVLRCRRVCQ SWNVAFRIGA NLLPMLKKRY        60
     PLAREVRQLD SESAESLETP EYDVRISQIF DKVTAKYDYL SRVTPQTMHR LKLCDDFGIT       120
     GERNWFPVQP WEYHASHLMQ RIDRPFGETF WSYDDGLLVY PSADHSCLVL MDMETDRKFM       180
     VPFMIVGRVI RRVRLQKRVL VIEWAENKAY HWLNDSDGVH RHFATSFDVN QKEDGWRVNF       240
     RNEWKIMFLG HPLSERDRFY STHTQTHYAI YIWQPNRSLY TADEDAPIES LSVWDISKPS       300
     DYRPSLDPTG RLRVESGGGE EDLGPTIITR FGFRELGFYG VRQRGLPAIQ SLNITDDDQS       360
     IEILEGTCAG RSPQVLVPDE WESEVWVTTI PIVGEGPCRR RRADFPLPPY RGNCSLQTNP       420
     ITFAICDEPW YSIVCESYDE QSQVGYCLYL EEQIWPVETA MFLAVGSPEY APEPANVLPE       480
     SLVMELTAMG KVCGTEDYLI GQSHNRELVI FRFDR                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page