(data stored in ACNUC7421 zone)

EMBL: AM269963.PE2

AM269963.PE2         Location/Qualifiers
FT   CDS             complement(join(2547..4534,4601..5606))
FT                   /locus_tag="An01g04450"
FT                   /EC_number="3.1.4.17"
FT                   /note="Catalytic activity: guanosine 3',5'-cyclic phosphate
FT                   + H2O = guanosine 5'-phosphate."
FT                   /note="Function: PDE9A of M. musculus and H. sapiens plays
FT                   a role in signal transduction by regulating the
FT                   intracellular concentration of cyclic nucleotides; this
FT                   phosphodiesterase has a high affinity for cGMP."
FT                   /note="Remark: in mammals a number of isoforms of PDE9A are
FT                   produced by alternative splicing."
FT                   /note="Similarity: the predicted protein is almost twice
FT                   longer as PDE9A of mammals, and the N- and C-terminal
FT                   regions show no similarity."
FT                   /note="Title: similarity to cGMP phosphodiesterase PDE9A
FT                   -Mus musculus"
FT                   /note="See PMID 9624145"
FT                   /note="See PMID 9856478"
FT                   /db_xref="GOA:A2Q8I3"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR036971"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I3"
FT                   /inference="profile:PFAM:PF00233"
FT                   /protein_id="CAK36980.1"
FT                   /translation="MDGIECSAIYIDHRVRSERWVYQGTPEAPAGAESDSGIIEEPESL
FT                   SSDVQVLLGVCKRIYLCQVGTAIANKLAEISDGAQSRCTPIFVFFDIDIHGEEAALQRR
FT                   RASRGSWPDVSPPSPASLRRGFTFTSQWEGAYDLKLLSGLSADIQVQDGPNVIVPVAVL
FT                   RPPFADPTSASPADQPRIPSFPDPQHISKCLDAGAVDVLVTPLDSCRAQALVVQAYRTR
FT                   KTALREQSRFLSRKKLRKHSWVGVNDEQPYAYLREAMVSKLMRGICNPEEVIEEFQDRE
FT                   LDVRPDRADFVREHIAQWGFTAHEFSDDELVLAAFEMLQHALQYPELEQWQLTPGELRT
FT                   FLLACRASYNSFVLYHNFRHAIDVLQSVFCFLLHIGALPPYGPNSPTIDDKCPMASLLT
FT                   PFDTLTLLISAIGHDVGHPGVNNFFLVKLNAPLAQLYNDNSVLEAFHCAAFSQILRRYW
FT                   PTAFKDRQLRKLLISSILATDMGVHQKFMERLGSLQEKFHENNRTVDGWKPQDLELYKT
FT                   LLCGLLIKCADISNVARPWDVAEKWTQILQEEFANQGEMEKEVGMETALFGGPPELGNI
FT                   YKLATGQIGFMSIFALPLFEGVSDILPDLKFTVEHIRSNQSKWHFLADMEKNRQTLQID
FT                   LRPDDLVSPRTQSPIPSLRGLHAPLAINSPKMPIKPALPTSEPVSQRSTADDYFGTAST
FT                   PLASDDSPSDYNENTISPVVSPDTPGPPMDITGCSMPSPDEAASRRSSGVIPEGQTNSP
FT                   SARLSDNMDGCSDAIRASSDPTVLAAVLFANGSAAGNGDTSGRSSARNSSVEGRPSSSR
FT                   HGPPSGRRQHANTASSGRTSGPSNSQRNSCTRTHSVSTYSNNMTPISPSTNATSFLSVD
FT                   SDEKGFPRESISRSDGEWDRANTRPATSNHPSVNAAYPSTRRASDPHNYDAAKVTSPVG
FT                   YGTSSSAQSTTTTGSMKHEGRGPRWDEHGSKEHAPPRKLPKRRSRLRLAFWKRRTHHSH
FT                   QHEVSGET"
     MDGIECSAIY IDHRVRSERW VYQGTPEAPA GAESDSGIIE EPESLSSDVQ VLLGVCKRIY        60
     LCQVGTAIAN KLAEISDGAQ SRCTPIFVFF DIDIHGEEAA LQRRRASRGS WPDVSPPSPA       120
     SLRRGFTFTS QWEGAYDLKL LSGLSADIQV QDGPNVIVPV AVLRPPFADP TSASPADQPR       180
     IPSFPDPQHI SKCLDAGAVD VLVTPLDSCR AQALVVQAYR TRKTALREQS RFLSRKKLRK       240
     HSWVGVNDEQ PYAYLREAMV SKLMRGICNP EEVIEEFQDR ELDVRPDRAD FVREHIAQWG       300
     FTAHEFSDDE LVLAAFEMLQ HALQYPELEQ WQLTPGELRT FLLACRASYN SFVLYHNFRH       360
     AIDVLQSVFC FLLHIGALPP YGPNSPTIDD KCPMASLLTP FDTLTLLISA IGHDVGHPGV       420
     NNFFLVKLNA PLAQLYNDNS VLEAFHCAAF SQILRRYWPT AFKDRQLRKL LISSILATDM       480
     GVHQKFMERL GSLQEKFHEN NRTVDGWKPQ DLELYKTLLC GLLIKCADIS NVARPWDVAE       540
     KWTQILQEEF ANQGEMEKEV GMETALFGGP PELGNIYKLA TGQIGFMSIF ALPLFEGVSD       600
     ILPDLKFTVE HIRSNQSKWH FLADMEKNRQ TLQIDLRPDD LVSPRTQSPI PSLRGLHAPL       660
     AINSPKMPIK PALPTSEPVS QRSTADDYFG TASTPLASDD SPSDYNENTI SPVVSPDTPG       720
     PPMDITGCSM PSPDEAASRR SSGVIPEGQT NSPSARLSDN MDGCSDAIRA SSDPTVLAAV       780
     LFANGSAAGN GDTSGRSSAR NSSVEGRPSS SRHGPPSGRR QHANTASSGR TSGPSNSQRN       840
     SCTRTHSVST YSNNMTPISP STNATSFLSV DSDEKGFPRE SISRSDGEWD RANTRPATSN       900
     HPSVNAAYPS TRRASDPHNY DAAKVTSPVG YGTSSSAQST TTTGSMKHEG RGPRWDEHGS       960
     KEHAPPRKLP KRRSRLRLAF WKRRTHHSHQ HEVSGET                                997
//

If you have problems or comments...

PBIL Back to PBIL home page