(data stored in ACNUC7421 zone)

EMBL: AM269963.PE20

AM269963.PE20        Location/Qualifiers
FT   CDS             complement(join(53785..53878,53930..53964,54017..54037,
FT                   54097..54209,54269..54843,55043..55098))
FT                   /locus_tag="An01g04630"
FT                   /EC_number="3.6.3.14"
FT                   /note="Complex: more in detail, ATP3 is a part of the F1
FT                   complex, a water soluble subunit which retain the ATPase
FT                   activity but not the proton-transporting activity."
FT                   /note="Function: ATP3 of S. cerevisiae is a component of
FT                   the H+-transporting ATP synthase complex, a mitochondrial
FT                   membrane-bound enzyme in which transport of protons is
FT                   coupled with ATP synthesis."
FT                   /note="Remark: in the gene model, a non conventional splice
FT                   donor (GC instead of GT) was used in the 3' position of
FT                   exon 4, due to the identity to A. niger EST SEQ ID NO:3921
FT                   of patent WO200056762-A2 and the local identity to the
FT                   fungal homologues."
FT                   /note="Title: strong similarity to gamma chain precursor of
FT                   the H+-transporting ATP synthase Atp3 - Saccharomyces
FT                   cerevisiae"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 7929329"
FT                   /note="See PMID 9857174"
FT                   /note="See PMID 10953875"
FT                   /note="See PMID 7498726"
FT                   /db_xref="GOA:A2Q8K1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K1"
FT                   /inference="profile:COGS:COG0224"
FT                   /inference="profile:PFAM:PF00231"
FT                   /inference="similar to AA sequence:PIR:S55891"
FT                   /protein_id="CAK36998.1"
FT                   /translation="MFSRAVRPAVRAGSIAVSRTAPPNAANFATLREIEGRLKSIKNIE
FT                   KITNTMKVIASTRLTRAQKAMEDSRAYGQTSNTVFENAETKPLEDKKTLLVVASSDKGL
FT                   CGGIHSGLSKATRRMLQQYPDADIVVLGEKAKAQLSRTNPNAIVLSFANVCKDIPTFND
FT                   AQSIADQISQLPTDYASVKIIYNQFINAQSYEAGTVEAYSEEAITQSPNLSTFETDDQT
FT                   LAHLREYALANNLFWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQAAIT
FT                   GELVEIITGATASADM"
     MFSRAVRPAV RAGSIAVSRT APPNAANFAT LREIEGRLKS IKNIEKITNT MKVIASTRLT        60
     RAQKAMEDSR AYGQTSNTVF ENAETKPLED KKTLLVVASS DKGLCGGIHS GLSKATRRML       120
     QQYPDADIVV LGEKAKAQLS RTNPNAIVLS FANVCKDIPT FNDAQSIADQ ISQLPTDYAS       180
     VKIIYNQFIN AQSYEAGTVE AYSEEAITQS PNLSTFETDD QTLAHLREYA LANNLFWAMA       240
     EGHACEISAR RNAMENASKN AGEMINKFQI LYNRQRQAAI TGELVEIITG ATASADM          297
//

If you have problems or comments...

PBIL Back to PBIL home page