(data stored in ACNUC7421 zone)

EMBL: AM269963.PE21

AM269963.PE21        Location/Qualifiers
FT   CDS             join(56107..56161,56347..56564,56660..58216,58267..58506,
FT                   58576..59025,59082..59216)
FT                   /locus_tag="An01g04640"
FT                   /EC_number="5.99.1.2"
FT                   /note="Catalytic activity: ATP-independent breakage of
FT                   single-stranded DNA,followed by passage and rejoining."
FT                   /note="Catalytic activity: when a topoisomerase transiently
FT                   breaks a DNA backbone bond,it simultaneously forms a
FT                   protein-DNA link,in which a tyrosyl oxygen in the enzyme is
FT                   joined to a DNA phosphorus at one end of the enzyme-severed
FT                   DNA strand."
FT                   /note="Function: the reaction catalyzed by topoisomerases
FT                   leads to the conversion of one topological isomer of DNA to
FT                   another; eukaryotic topoisomerase I and II can relax both
FT                   negative and positive supercoils, whereas prokaryotic
FT                   enzymes relax only negative supercoils."
FT                   /note="Similarity: the predicted protein shows very strong
FT                   similarity to the A. nidulans topoisomerase, whose
FT                   catalytic activity was not experimentally reported."
FT                   /note="Title: strong similarity to topoisomerase I CaTOP1
FT                   -Candida albicans"
FT                   /note="nucleus"
FT                   /note="See PMID 9026437"
FT                   /db_xref="GOA:A2Q8K2"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="InterPro:IPR025834"
FT                   /db_xref="InterPro:IPR036202"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K2"
FT                   /inference="profile:COGS:COG3569"
FT                   /inference="profile:PFAM:PF01028"
FT                   /inference="profile:PFAM:PF02919"
FT                   /inference="similar to AA sequence:UniProtKB:CAU41342.1"
FT                   /protein_id="CAK36999.1"
FT                   /translation="MSSSEDDTPLVQANGRRISSHTDSKMRDATETNGHVDPGVSIRFG
FT                   PVQAENDVDMADADAAAVPKRKSRSSVGQRKSYAEPESSEEDDQPLSKRRRTSVKHEDP
FT                   ETDDDVPLALNGRKLPKASETAIGEESDSDVPIERKLASQKKKIQQKAEKDAKVTRKPA
FT                   PPKTTKTAATKRQTNGVKKEPEDVKPSTVKKTAKPTKASDKAALSSQVKRAASSAKSTP
FT                   VKKEESEEAEDADEEEYRWWEDPTKGDGTIKWTTLEHNGVVFPPPYEPLPKNVKMKYDG
FT                   IPVTLHPDAEEVAGFFGGMLNATQHVENPTFQKNFFMDFRDILKKTGGAKDPKGNKVDI
FT                   KDFHKCDFQPIFAYYDNQRQEKKALPPAEKKRLKAEKDAQEAPYMFCMWDGRKQKVGNF
FT                   RVEPPALFRGRGEHPKTGRVKSRVQPEQITINIGKDAPVPPPPEGHKWKEVKHDQEGTW
FT                   LAMWQENINGNYKYVMLAANSDVKGQSDYKKFEKARELKHHIGRIRKDYQKNLKHELMV
FT                   ERQKATAVYLIDQFALRAGNEKGEDEAETVGCCSLKYENVTLKPPNKVVFDFLGKDSIR
FT                   FYDEVEVDAQVFKNLKIFKKAPKKEGDEIFDRLTTSALNKHLSAYMQGLTAKVFRTYNA
FT                   SHTMSTLLKDMKATGNIAEKVKAYNDANRKVAILCNHKRTVAASHANQMEKMSERIKGL
FT                   RYQRWRLKQQMLDLEPSLKKKKGAKYFEMDEDMDLEWVKEHQAFLVEEQRQKIQKKFEK
FT                   DNEKLAAEGEKEMKATELESRLQVAKDLEKKFNKENKTGKVEAEGKAPTVDKIEAAITK
FT                   LEQRIETMELQAQDKEENKEVALGTSKINYIDPRLTVVFSKKFDVPIEKFFSKSLREKF
FT                   EWAIKSVDEDWEF"
     MSSSEDDTPL VQANGRRISS HTDSKMRDAT ETNGHVDPGV SIRFGPVQAE NDVDMADADA        60
     AAVPKRKSRS SVGQRKSYAE PESSEEDDQP LSKRRRTSVK HEDPETDDDV PLALNGRKLP       120
     KASETAIGEE SDSDVPIERK LASQKKKIQQ KAEKDAKVTR KPAPPKTTKT AATKRQTNGV       180
     KKEPEDVKPS TVKKTAKPTK ASDKAALSSQ VKRAASSAKS TPVKKEESEE AEDADEEEYR       240
     WWEDPTKGDG TIKWTTLEHN GVVFPPPYEP LPKNVKMKYD GIPVTLHPDA EEVAGFFGGM       300
     LNATQHVENP TFQKNFFMDF RDILKKTGGA KDPKGNKVDI KDFHKCDFQP IFAYYDNQRQ       360
     EKKALPPAEK KRLKAEKDAQ EAPYMFCMWD GRKQKVGNFR VEPPALFRGR GEHPKTGRVK       420
     SRVQPEQITI NIGKDAPVPP PPEGHKWKEV KHDQEGTWLA MWQENINGNY KYVMLAANSD       480
     VKGQSDYKKF EKARELKHHI GRIRKDYQKN LKHELMVERQ KATAVYLIDQ FALRAGNEKG       540
     EDEAETVGCC SLKYENVTLK PPNKVVFDFL GKDSIRFYDE VEVDAQVFKN LKIFKKAPKK       600
     EGDEIFDRLT TSALNKHLSA YMQGLTAKVF RTYNASHTMS TLLKDMKATG NIAEKVKAYN       660
     DANRKVAILC NHKRTVAASH ANQMEKMSER IKGLRYQRWR LKQQMLDLEP SLKKKKGAKY       720
     FEMDEDMDLE WVKEHQAFLV EEQRQKIQKK FEKDNEKLAA EGEKEMKATE LESRLQVAKD       780
     LEKKFNKENK TGKVEAEGKA PTVDKIEAAI TKLEQRIETM ELQAQDKEEN KEVALGTSKI       840
     NYIDPRLTVV FSKKFDVPIE KFFSKSLREK FEWAIKSVDE DWEF                        884
//

If you have problems or comments...

PBIL Back to PBIL home page