(data stored in ACNUC7421 zone)

EMBL: AM269963.PE22

AM269963.PE22        Location/Qualifiers
FT   CDS             complement(join(60794..61704,61806..61967,62042..62093))
FT                   /locus_tag="An01g04650"
FT                   /note="Remark: the encoded protein also shows weak
FT                   similarities to UDPglucose 4-epimerase galE from Neisseria
FT                   gonorrhoeae."
FT                   /note="Title: strong similarity to sequence SEQ ID NO:12396
FT                   from patent WO200171042-A2 - Drosophila melanogaster"
FT                   /db_xref="GOA:A2Q8K3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K3"
FT                   /inference="profile:COGS:COG0451"
FT                   /inference="profile:COGS:COG1088"
FT                   /protein_id="CAK37000.1"
FT                   /translation="MADEQSKKPAVLIVGGLGFIGRHLALYLHENNLASEVRLVDKVLP
FT                   QLAWLAPEFQEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGETRHSQPDDV
FT                   YEVRSYALTVALGREVARRGIRSFVECSTAHVYKGGSSPRKEDDKLQPWHKLAKWKMKA
FT                   SEELQKIPGLNYCLLRLPHVYGEYDSGYFAMGICLARVHLELEKDLELLYTKDLKINTV
FT                   YVRDAASALWKAAEWRASAPTDGSAPLAFNVVDHGNTRQEDIAQALSEVFKLKCDFLGS
FT                   LASQFAKLNLDDVVDDMNEECLQGWADLLEEKKIERPGPIGPFLEKDVLKDQDMCLDGT
FT                   LFETTTGWKPSRERFNADAVRDMVDSYKRMGWWP"
     MADEQSKKPA VLIVGGLGFI GRHLALYLHE NNLASEVRLV DKVLPQLAWL APEFQEACSK        60
     DKFVQADASR EQHFPRIFDR ANGEQFDYVI NCGGETRHSQ PDDVYEVRSY ALTVALGREV       120
     ARRGIRSFVE CSTAHVYKGG SSPRKEDDKL QPWHKLAKWK MKASEELQKI PGLNYCLLRL       180
     PHVYGEYDSG YFAMGICLAR VHLELEKDLE LLYTKDLKIN TVYVRDAASA LWKAAEWRAS       240
     APTDGSAPLA FNVVDHGNTR QEDIAQALSE VFKLKCDFLG SLASQFAKLN LDDVVDDMNE       300
     ECLQGWADLL EEKKIERPGP IGPFLEKDVL KDQDMCLDGT LFETTTGWKP SRERFNADAV       360
     RDMVDSYKRM GWWP                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page