(data stored in ACNUC7421 zone)

EMBL: AM269963.PE23

AM269963.PE23        Location/Qualifiers
FT   CDS             complement(join(65019..65846,65920..65995,66302..66660))
FT                   /locus_tag="An01g04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8K4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K4"
FT                   /protein_id="CAK37001.1"
FT                   /translation="MSSPSSPACSSSGAETMKELLDRGEVKASWRDKQFVHFLDLKEEY
FT                   GREFLNLVKEHVEPNRFEWTDILTSENERRACAKDFVAQYGLKYWGTPANRKKYLQEES
FT                   LADEKTLCTYPAQSEEIVRTIEILLLRKAKGYSRLSQEKAKSTQLTKSPFEAGNTSKRK
FT                   STLKETDEDTDKPVYKTRTRSTPSAIRPFKTIVCESEPEAEFQSSAAKKTKKQRTSLAR
FT                   CYTGTPEVQLPPSRGKDGMSAPHQGTFVHRAASQYAKNTKFPATEGSQSVIAAAQYAQD
FT                   TKLLATENNHIGTTASQYFKDTKFLVTASNQVGMAPVWLPFTDFDQATEFLEHMAKQCN
FT                   VMEWSPSEQLKWESMPPQVIAASVRFDWSDFEIRVRRERNEDLLLMLQELSNAWQAEDE
FT                   GKEGASGSVYKIKVMLHIGIC"
     MSSPSSPACS SSGAETMKEL LDRGEVKASW RDKQFVHFLD LKEEYGREFL NLVKEHVEPN        60
     RFEWTDILTS ENERRACAKD FVAQYGLKYW GTPANRKKYL QEESLADEKT LCTYPAQSEE       120
     IVRTIEILLL RKAKGYSRLS QEKAKSTQLT KSPFEAGNTS KRKSTLKETD EDTDKPVYKT       180
     RTRSTPSAIR PFKTIVCESE PEAEFQSSAA KKTKKQRTSL ARCYTGTPEV QLPPSRGKDG       240
     MSAPHQGTFV HRAASQYAKN TKFPATEGSQ SVIAAAQYAQ DTKLLATENN HIGTTASQYF       300
     KDTKFLVTAS NQVGMAPVWL PFTDFDQATE FLEHMAKQCN VMEWSPSEQL KWESMPPQVI       360
     AASVRFDWSD FEIRVRRERN EDLLLMLQEL SNAWQAEDEG KEGASGSVYK IKVMLHIGIC       420
//

If you have problems or comments...

PBIL Back to PBIL home page