(data stored in ACNUC7421 zone)

EMBL: AM269963.PE24

AM269963.PE24        Location/Qualifiers
FT   CDS             complement(join(67438..68362,68414..68541,68619..68719,
FT                   68798..68900))
FT                   /locus_tag="An01g04670"
FT                   /note="Similarity: proline-rich regions lead to a variety
FT                   of unspecific similarities."
FT                   /note="Title: similarity to hypothetical protein F10M23.90
FT                   - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8K5"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="InterPro:IPR039431"
FT                   /db_xref="InterPro:IPR041212"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K5"
FT                   /inference="similar to AA sequence:PIR:T04798"
FT                   /protein_id="CAK37002.1"
FT                   /translation="MASNIPASLRSADIGRYALRAAQLERAKPVVAYWCNFWIVNQIIG
FT                   RGLHTSDDDVKQYTTDLVDKLEQFKSENVDNDAVTDAVAANAYVEQFGLEVLGRAEATM
FT                   KANKVTKQTADTFQAAATFLELCQIWTNPPEPEIAAKIKFCKYHAVRIIKAIKAGEDPN
FT                   ASNPAPTEEDELESELRGMEAKQDDPEVQAIVGSSAAPPGQPSVEEVPDESTQPSQSPL
FT                   SLPQPPTTFADAPAAHYGADPMSTSNMEDDAETGAPLNLPSAPETFTSPAPSVPNLPDT
FT                   PADIGAKPPQARADSFHSFPPPSSIPPSSPSAASHDASSFYTRPTSGVAPPPPFVQSSS
FT                   ATAPVVSRPTPQSIPSSTPPPPAPAASSSSGVNAQSLDDQAIALAQKHARWAVSALTFD
FT                   DVNTAIKELKNSLRYLGAE"
     MASNIPASLR SADIGRYALR AAQLERAKPV VAYWCNFWIV NQIIGRGLHT SDDDVKQYTT        60
     DLVDKLEQFK SENVDNDAVT DAVAANAYVE QFGLEVLGRA EATMKANKVT KQTADTFQAA       120
     ATFLELCQIW TNPPEPEIAA KIKFCKYHAV RIIKAIKAGE DPNASNPAPT EEDELESELR       180
     GMEAKQDDPE VQAIVGSSAA PPGQPSVEEV PDESTQPSQS PLSLPQPPTT FADAPAAHYG       240
     ADPMSTSNME DDAETGAPLN LPSAPETFTS PAPSVPNLPD TPADIGAKPP QARADSFHSF       300
     PPPSSIPPSS PSAASHDASS FYTRPTSGVA PPPPFVQSSS ATAPVVSRPT PQSIPSSTPP       360
     PPAPAASSSS GVNAQSLDDQ AIALAQKHAR WAVSALTFDD VNTAIKELKN SLRYLGAE         418
//

If you have problems or comments...

PBIL Back to PBIL home page