(data stored in ACNUC7421 zone)

EMBL: AM269963.PE25

AM269963.PE25        Location/Qualifiers
FT   CDS             complement(join(69298..71214,71271..71502,71574..71947,
FT                   72027..72077))
FT                   /locus_tag="An01g04680"
FT                   /note="Function: palB of A. nidulans is a factor involved
FT                   in ambient pH signalling transduction pathway."
FT                   /note="Remark: calpains are cytosolic cysteine proteases
FT                   that are activated by a rise in intracellular Ca2+, and are
FT                   believed to function in stimulating Ca2+ signaling."
FT                   /note="Title: strong similarity to calpain-like protease
FT                   palB - Aspergillus nidulans"
FT                   /note="cytoplasm"
FT                   /note="See PMID 7499363"
FT                   /note="See PMID 7581026"
FT                   /db_xref="GOA:A2Q8K6"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K6"
FT                   /inference="profile:PFAM:PF04212"
FT                   /inference="similar to AA sequence:UniProtKB:ANPALBGN.1"
FT                   /protein_id="CAK37003.1"
FT                   /translation="MSRPNAASKKFLVNQALKAERDASSALTQGQALESAIDAAENYMK
FT                   ALSLTTESKDRQALDAKCKEWLTRAERIKQDKDWQAVLQIHEKSGLTARFPKSTRKLTT
FT                   REEIILLESAKLNGFIFPPWENAPGPEDFEKGDEGLFTDKPDLHLSKLQRRILAGWERP
FT                   FDLLSKHANGIDGLKSKMPVMSVSGPTDLVQDMLTDCSVVASLCAATSRSERGLDKHHL
FT                   PIVFPCEYGQVNPRISPSGKYIFRFYFNGCFRKVVIDDRLPASKTSRSLHVVDRNHPNF
FT                   LWPAFVEKAYLKLRGGYDFPGSNSGTDLWVLTGWIPEQVFLHQDDVTAEQLWRRLFKRF
FT                   RNGDVLLTIGTGKLTEREQKELGFASEHDYAILDMREQRDRRQMLVKNPWAGDDAITGD
FT                   IADSFALGHTSHTPASSLPRTYWMDCESVLQNFENLYLNWNPGIFRYREDIHFAWDLST
FT                   ARGVAGCFAKNPQFAVTSEVGGKVWLLLGKHFRSIHHDEQTQVPQDDLEPGFISIYVFN
FT                   ANGKRVALSEGALHRGPYVDSPNTLMRLEMPPGTTYTVVVSEQSLPAVSQNFTLSALSD
FT                   NPLLLAPAQNRYACLTKTQGLWMPSTAGGNAESARYPFNPQFRLEVHDDTDISILLEPS
FT                   EPELATHVKLFWSNGERVTRVRNRDIITDSGDYRRGGSLAEKKRLGEGVYTLVCSTFAP
FT                   DQLGRFTLWISSALPCVVKPLAPEAAGRRAVISDIGILTPGKDRMLASLETKRLTRIKL
FT                   IGRSRLSTIGNRAVGPSPMLMTVELGQGPYKEILATSEDGNHSDAISGVRIEDFDLHPG
FT                   LADQGGAWIVIERIGGPGGQVEDHFEVEALAEERVDIGEWIVEDA"
     MSRPNAASKK FLVNQALKAE RDASSALTQG QALESAIDAA ENYMKALSLT TESKDRQALD        60
     AKCKEWLTRA ERIKQDKDWQ AVLQIHEKSG LTARFPKSTR KLTTREEIIL LESAKLNGFI       120
     FPPWENAPGP EDFEKGDEGL FTDKPDLHLS KLQRRILAGW ERPFDLLSKH ANGIDGLKSK       180
     MPVMSVSGPT DLVQDMLTDC SVVASLCAAT SRSERGLDKH HLPIVFPCEY GQVNPRISPS       240
     GKYIFRFYFN GCFRKVVIDD RLPASKTSRS LHVVDRNHPN FLWPAFVEKA YLKLRGGYDF       300
     PGSNSGTDLW VLTGWIPEQV FLHQDDVTAE QLWRRLFKRF RNGDVLLTIG TGKLTEREQK       360
     ELGFASEHDY AILDMREQRD RRQMLVKNPW AGDDAITGDI ADSFALGHTS HTPASSLPRT       420
     YWMDCESVLQ NFENLYLNWN PGIFRYREDI HFAWDLSTAR GVAGCFAKNP QFAVTSEVGG       480
     KVWLLLGKHF RSIHHDEQTQ VPQDDLEPGF ISIYVFNANG KRVALSEGAL HRGPYVDSPN       540
     TLMRLEMPPG TTYTVVVSEQ SLPAVSQNFT LSALSDNPLL LAPAQNRYAC LTKTQGLWMP       600
     STAGGNAESA RYPFNPQFRL EVHDDTDISI LLEPSEPELA THVKLFWSNG ERVTRVRNRD       660
     IITDSGDYRR GGSLAEKKRL GEGVYTLVCS TFAPDQLGRF TLWISSALPC VVKPLAPEAA       720
     GRRAVISDIG ILTPGKDRML ASLETKRLTR IKLIGRSRLS TIGNRAVGPS PMLMTVELGQ       780
     GPYKEILATS EDGNHSDAIS GVRIEDFDLH PGLADQGGAW IVIERIGGPG GQVEDHFEVE       840
     ALAEERVDIG EWIVEDA                                                      857
//

If you have problems or comments...

PBIL Back to PBIL home page