(data stored in ACNUC7421 zone)

EMBL: AM269963.PE26

AM269963.PE26        Location/Qualifiers
FT   CDS             join(72939..73039,73112..73656,73712..73949,74000..74123)
FT                   /locus_tag="An01g04690"
FT                   /note="Function: Ant1 of S. cerevisiae is a peroxisomal
FT                   transporter involved in the transport of cytoplasmic ATP
FT                   into the peroxisomal lumen in exchange for AMP."
FT                   /note="Induction: Ant1 of S. cerevisiae is induced by oleic
FT                   acid."
FT                   /note="Localization: Ant1 of S. cerevisiae is localized in
FT                   the peroxisomal membrane."
FT                   /note="Remark: ATP imported into the peroxisome is required
FT                   for the activation of fatty acids."
FT                   /note="Title: strong similarity to peroxisomal transporter
FT                   Ant1 - Saccharomyces cerevisiae"
FT                   /note="peroxisome"
FT                   /note="See PMID 11566870"
FT                   /db_xref="GOA:A2Q8K7"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K7"
FT                   /inference="profile:PFAM:PF00153"
FT                   /inference="similar to AA sequence:PIR:S69019"
FT                   /protein_id="CAK37004.1"
FT                   /translation="MAGQSKPALSPWGSAVAGATGAVLANALVYPLDLVKTKLQVQVKT
FT                   NDAKDENSETVHYKSTLDAITKIVEKEGVEGLYSGIVGSLIGVASTNFAYFYWYTVVRA
FT                   FYMASNKVPKPPGTAIELSLGAVAGAVAQIFTIPVAVITTRQQTQAKNERKGLIETGKE
FT                   IVDSEDGWTGLWRGLKASLILVVNPAITYGAYQRLKDIIFPGKNSLKPWEAFLLGALSK
FT                   ALATIATQPLIVAKVGLQSRPPPSREGKPFKTFGEVMRYIVQNEGLLSLFKGIGPQIMK
FT                   GLLVQGLLMMTKERVELIFVLLFAYLRKIREQKLKKLADSAASTAKTSLPATLK"
     MAGQSKPALS PWGSAVAGAT GAVLANALVY PLDLVKTKLQ VQVKTNDAKD ENSETVHYKS        60
     TLDAITKIVE KEGVEGLYSG IVGSLIGVAS TNFAYFYWYT VVRAFYMASN KVPKPPGTAI       120
     ELSLGAVAGA VAQIFTIPVA VITTRQQTQA KNERKGLIET GKEIVDSEDG WTGLWRGLKA       180
     SLILVVNPAI TYGAYQRLKD IIFPGKNSLK PWEAFLLGAL SKALATIATQ PLIVAKVGLQ       240
     SRPPPSREGK PFKTFGEVMR YIVQNEGLLS LFKGIGPQIM KGLLVQGLLM MTKERVELIF       300
     VLLFAYLRKI REQKLKKLAD SAASTAKTSL PATLK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page