(data stored in ACNUC7421 zone)

EMBL: AM269963.PE27

AM269963.PE27        Location/Qualifiers
FT   CDS             join(74670..75047,75135..75584)
FT                   /locus_tag="An01g04700"
FT                   /note="Title: weak similarity to thermostable nuclease
FT                   Tnase nuch - Staphylococcus hyicus"
FT                   /note="See PMID 8045422"
FT                   /db_xref="GOA:A2Q8K8"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8K8"
FT                   /inference="profile:COGS:COG1525"
FT                   /inference="profile:PFAM:PF00565"
FT                   /inference="similar to AA sequence:SWISSPROT:NUC.STAHY"
FT                   /protein_id="CAK37005.1"
FT                   /translation="MRWPPWASNTQASNNDHPTTTNNNDPKNLLDWSAFTELRTLIPTL
FT                   VLTTGILSAFTLHRNYLRRFPTAVNITPAYYRRRSILGKVTSVGDGDNFRIYHTPGGRL
FT                   AGWGWVPWKKVPTTRKELRDQTIHVRIAGVDAPEQAHFGRPAQPFGKEAHEWLTGYLIN
FT                   RRVRIYVHRQDQYQRVVATVFVRRALDFPVPFRRRDVGYEMLRKGLATVYEAKVGAEFG
FT                   GEVMEKKYRSAEWWAKARGLGLWKGFKKNRDAWESPREFKTRTGMEDVGDGKK"
     MRWPPWASNT QASNNDHPTT TNNNDPKNLL DWSAFTELRT LIPTLVLTTG ILSAFTLHRN        60
     YLRRFPTAVN ITPAYYRRRS ILGKVTSVGD GDNFRIYHTP GGRLAGWGWV PWKKVPTTRK       120
     ELRDQTIHVR IAGVDAPEQA HFGRPAQPFG KEAHEWLTGY LINRRVRIYV HRQDQYQRVV       180
     ATVFVRRALD FPVPFRRRDV GYEMLRKGLA TVYEAKVGAE FGGEVMEKKY RSAEWWAKAR       240
     GLGLWKGFKK NRDAWESPRE FKTRTGMEDV GDGKK                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page