(data stored in ACNUC7421 zone)

EMBL: AM269963.PE28

AM269963.PE28        Location/Qualifiers
FT   CDS             complement(join(76065..76597,76678..76849))
FT                   /locus_tag="An01g04710"
FT                   /EC_number="2.7.4.3"
FT                   /note="Catalytic activity: ATP + AMP = ADP + ADP."
FT                   /note="Function: adenylate kinase is required for cell
FT                   maintenance and cell growth."
FT                   /note="Localization: adenylate kinase ADK2 from S.
FT                   cerevisiae is located in the mitochindrial matrix."
FT                   /note="Remark: ADK2 of S. cerevisiae is also known as
FT                   AKY3,PAK3 and YER170W."
FT                   /note="Similarity: adenylate kinases are highly conserved."
FT                   /note="Title: strong similarity to adenylate kinase Adk2
FT                   -Saccharomyces cerevisiae"
FT                   /note="See PMID 9425120"
FT                   /note="See PMID 1587477"
FT                   /note="See PMID 1620094"
FT                   /db_xref="GOA:A2Q8K9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028586"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K9"
FT                   /inference="profile:COGS:COG0563"
FT                   /inference="profile:PFAM:PF00406"
FT                   /inference="profile:PFAM:PF05191"
FT                   /inference="similar to AA sequence:PIR:S23568"
FT                   /protein_id="CAK37006.1"
FT                   /translation="MTATIRQLRKAARIILIGAPGVGKGTQTERLLTRYPELASISSGD
FT                   LLRENVRRKTPLGLQAEATMQSGNLVPDSMILDLISSEFKSRGWLSSAPTSSILPSASF
FT                   ILDGFPRTATQASSLETIVPVNFVVHLVTPPSVILSRIASRWVHEPSGRVYNTDFNAPK
FT                   VPGKDDVTGEPLTQREDDSIDTWKQRLHKFEETSKALLEHYQRKGCLWRVEGDTSDEIS
FT                   PKLFAEIERQFC"
     MTATIRQLRK AARIILIGAP GVGKGTQTER LLTRYPELAS ISSGDLLREN VRRKTPLGLQ        60
     AEATMQSGNL VPDSMILDLI SSEFKSRGWL SSAPTSSILP SASFILDGFP RTATQASSLE       120
     TIVPVNFVVH LVTPPSVILS RIASRWVHEP SGRVYNTDFN APKVPGKDDV TGEPLTQRED       180
     DSIDTWKQRL HKFEETSKAL LEHYQRKGCL WRVEGDTSDE ISPKLFAEIE RQFC             234
//

If you have problems or comments...

PBIL Back to PBIL home page