(data stored in ACNUC7421 zone)

EMBL: AM269963.PE29

AM269963.PE29        Location/Qualifiers
FT   CDS             join(77893..78082,78135..78685,78737..79498)
FT                   /locus_tag="An01g04720"
FT                   /EC_number="2.7.7.-"
FT                   /note="Complex: eukaryotic DNA primase is a heterodimer of
FT                   a large subunit (p58) and a small subunit (p48)."
FT                   /note="Function: DNA primase initiates the synthesis of new
FT                   DNA strands by synthesizing short RNA oligomers on
FT                   single-stranded DNA, is essential for telomere maintenance
FT                   and so chromosome stability."
FT                   /note="Title: strong similarity to DNA primase large
FT                   subunit Pri2 - Saccharomyces cerevisiae"
FT                   /note="See PMID 11084371"
FT                   /note="See PMID 2528682"
FT                   /db_xref="GOA:A2Q8L0"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L0"
FT                   /inference="profile:COGS:COG2219"
FT                   /inference="profile:PFAM:PF04104"
FT                   /inference="similar to AA sequence:PIR:A32497"
FT                   /protein_id="CAK37007.1"
FT                   /translation="MIRQDFRRIDPKRRATLDHKKKQFATPVFKQQDYPHRLNFYEVPP
FT                   TDEITLEQFEQWAIDRLKVLAEIEACSYRNKSPAETEAHITPHLQKYLPLSSNTSSSNG
FT                   AADQRLKNERQKDHYSHFILRLAFSATEELRRRFVRAETMLFRFRFQRDDTRERRAFIE
FT                   SLNLDWEPVDDEEKQRLAEQLLAASPGLRRIDDETWYKVDWEKVPELVERRAVFLSKGK
FT                   AYVPGREQLSMIIAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYT
FT                   ENEGFVDGAPITANNIDRLSQHFPLCMRSLHMNLRKNNHLKHYGRLQYTLFLKGIGLSL
FT                   EECIVFWRQGFKGLTDDEFNSRYKYNIRHAYGDVGGDQNRRGRGYPPYSCQKILGDSNP
FT                   GVGQTHGCPYRHFSVDNLIGLLQSTGVNDRDVLRGVREDVEKMRFHIACNRVFEHTHKA
FT                   DIKRVKEDGTWNQTDLDTIVHPNTYFKRSYLLKQMGKAPKNA"
     MIRQDFRRID PKRRATLDHK KKQFATPVFK QQDYPHRLNF YEVPPTDEIT LEQFEQWAID        60
     RLKVLAEIEA CSYRNKSPAE TEAHITPHLQ KYLPLSSNTS SSNGAADQRL KNERQKDHYS       120
     HFILRLAFSA TEELRRRFVR AETMLFRFRF QRDDTRERRA FIESLNLDWE PVDDEEKQRL       180
     AEQLLAASPG LRRIDDETWY KVDWEKVPEL VERRAVFLSK GKAYVPGREQ LSMIIAEFTA       240
     RLERALELTS RALPRLDEDD RLTPILNHLS KNFGSAESVY TENEGFVDGA PITANNIDRL       300
     SQHFPLCMRS LHMNLRKNNH LKHYGRLQYT LFLKGIGLSL EECIVFWRQG FKGLTDDEFN       360
     SRYKYNIRHA YGDVGGDQNR RGRGYPPYSC QKILGDSNPG VGQTHGCPYR HFSVDNLIGL       420
     LQSTGVNDRD VLRGVREDVE KMRFHIACNR VFEHTHKADI KRVKEDGTWN QTDLDTIVHP       480
     NTYFKRSYLL KQMGKAPKNA                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page