(data stored in ACNUC7421 zone)

EMBL: AM269963.PE3

AM269963.PE3         Location/Qualifiers
FT   CDS             complement(join(5662..5911,6331..6398,6515..6547))
FT                   /locus_tag="An01g04455"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8I4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I4"
FT                   /protein_id="CAK36981.1"
FT                   /translation="MCRDLSVFPRWPNFYQSLRHLALLLTSVDPLPHLTQFRIQLYNVT
FT                   DRKSLLFFFTSTFSTLLRSSLYPYTGRSFLPEISRPSHSTCTTISINHMNPSSDRLGCY
FT                   LFSFHICCCPET"
     MCRDLSVFPR WPNFYQSLRH LALLLTSVDP LPHLTQFRIQ LYNVTDRKSL LFFFTSTFST        60
     LLRSSLYPYT GRSFLPEISR PSHSTCTTIS INHMNPSSDR LGCYLFSFHI CCCPET           116
//

If you have problems or comments...

PBIL Back to PBIL home page