(data stored in ACNUC7421 zone)

EMBL: AM269963.PE31

AM269963.PE31        Location/Qualifiers
FT   CDS             join(83371..83374,83435..83468,83535..83655,83722..84046,
FT                   84102..84115)
FT                   /locus_tag="An01g04740"
FT                   /note="Remark: the ORF overlaps with A. niger EST an_2410
FT                   in EMBLEST."
FT                   /note="Similarity: ribosomal protein L12 is highly
FT                   conserved."
FT                   /note="Title: strong similarity to ribosomal protein of the
FT                   large subunit L12 - Mus musculus"
FT                   /note="See PMID 8359697"
FT                   /db_xref="GOA:A2Q8L2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L2"
FT                   /inference="profile:COGS:COG0080"
FT                   /inference="profile:PFAM:PF00298"
FT                   /inference="profile:PFAM:PF03946"
FT                   /inference="similar to AA sequence:PIR:JN0778"
FT                   /protein_id="CAK37009.1"
FT                   /translation="MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGED
FT                   IAKNTGDWKGLRVTVRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSI
FT                   PLDEIIEIARKMRHRSLAKELKGTVLEILGTAFSVGCQVDGRSPKDVSDDVKAGEIDIP
FT                   SE"
     MPPKFDPNEV KIIHLRVTGG EVGAQSALAP KIGPLGLSPK KIGEDIAKNT GDWKGLRVTV        60
     RLTIQNRQAA VSVVPSASSL VIKALKEPPR DRKKEKNIKH SKSIPLDEII EIARKMRHRS       120
     LAKELKGTVL EILGTAFSVG CQVDGRSPKD VSDDVKAGEI DIPSE                       165
//

If you have problems or comments...

PBIL Back to PBIL home page