(data stored in ACNUC7421 zone)

EMBL: AM269963.PE32

AM269963.PE32        Location/Qualifiers
FT   CDS             complement(join(86479..86545,86587..86759))
FT                   /locus_tag="An01g04750"
FT                   /product="hypothetical protein"
FT                   /note="Remark: the ORF is a short."
FT                   /db_xref="GOA:A2Q8L3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L3"
FT                   /protein_id="CAK37010.1"
FT                   /translation="MRIHRREAETSGHKPKASIILQPWRHPEAEKKIPTKTHAASDQVE
FT                   KMAESLPLDKYLRARCRYKRDDCQWDSDRLPSLL"
     MRIHRREAET SGHKPKASII LQPWRHPEAE KKIPTKTHAA SDQVEKMAES LPLDKYLRAR        60
     CRYKRDDCQW DSDRLPSLL                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page