(data stored in ACNUC7421 zone)

EMBL: AM269963.PE34

AM269963.PE34        Location/Qualifiers
FT   CDS             complement(95615..97285)
FT                   /locus_tag="An01g04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8L5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L5"
FT                   /protein_id="CAK37012.1"
FT                   /translation="MAEQFNKLVDTIGGLSLADRSTSHCSNPTQTLVKTIWELVKSCQS
FT                   TSANAAHVGTVIEGTQTPSGQDIARLSSLRKEAVALEQITKNLSDATENYIIAYIISLA
FT                   GPWTLEQKMLLHFSDEVRRIIRNVLDDANTDDCSVVRKILENCYDQSLRASGTLHPAEY
FT                   FDSLEEASLEEPYDPDFESEEYYEHENRLAIDDSYAETLRVQCERRAEREQQQREEWIG
FT                   FWVRALGQCPDEPTTLFYSPANSLLNSHLAEVPRYLFRAFDDASSGWSDNHIVASAESR
FT                   AAISERSRTDLLSRSRGEITRMLYSHLKKSLFGAEDTDNLMSWSSSLMFVIQYAIWRCN
FT                   KRRCDPSEVKICMVDTRKFPRGQFARDKSLLRAYRDAPELDENRRRFFDFRLEDPYYDN
FT                   GEYLSQGVLHHAGRSSVVSLEQLIHAGLYDLYPEFRDPASRNLWTNRVGSLRLAWSNEH
FT                   TTTQLDIRSAVKVARECFNNYFNALDIALVLLSFKERKLRTPATKAPQQQRNSHDFGPV
FT                   EVQRYTTIIEDMMAKARGIPIALRGFTADSQLEEIFECS"
     MAEQFNKLVD TIGGLSLADR STSHCSNPTQ TLVKTIWELV KSCQSTSANA AHVGTVIEGT        60
     QTPSGQDIAR LSSLRKEAVA LEQITKNLSD ATENYIIAYI ISLAGPWTLE QKMLLHFSDE       120
     VRRIIRNVLD DANTDDCSVV RKILENCYDQ SLRASGTLHP AEYFDSLEEA SLEEPYDPDF       180
     ESEEYYEHEN RLAIDDSYAE TLRVQCERRA EREQQQREEW IGFWVRALGQ CPDEPTTLFY       240
     SPANSLLNSH LAEVPRYLFR AFDDASSGWS DNHIVASAES RAAISERSRT DLLSRSRGEI       300
     TRMLYSHLKK SLFGAEDTDN LMSWSSSLMF VIQYAIWRCN KRRCDPSEVK ICMVDTRKFP       360
     RGQFARDKSL LRAYRDAPEL DENRRRFFDF RLEDPYYDNG EYLSQGVLHH AGRSSVVSLE       420
     QLIHAGLYDL YPEFRDPASR NLWTNRVGSL RLAWSNEHTT TQLDIRSAVK VARECFNNYF       480
     NALDIALVLL SFKERKLRTP ATKAPQQQRN SHDFGPVEVQ RYTTIIEDMM AKARGIPIAL       540
     RGFTADSQLE EIFECS                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page