(data stored in ACNUC7421 zone)

EMBL: AM269963.PE35

AM269963.PE35        Location/Qualifiers
FT   CDS             complement(join(98181..98246,98418..98504,98612..98774,
FT                   98868..98912,99029..99100,99196..99260))
FT                   /locus_tag="An01g04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8L6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L6"
FT                   /protein_id="CAK37013.1"
FT                   /translation="MEYLLHRICPASFPGLVAFTTNRAKYASGVDHTAPNETIDGKRMA
FT                   HGLASSNATKKCSKDSPSQSVSVIFNRSSICELGMYLLRSYTDVSQLDRCRLLPYYLST
FT                   QLQALVRNQYAPSSTYLNETPNTFAVSLALDIIRQAPLAENETEGYCDHSMVMSNRLIW
FT                   VV"
     MEYLLHRICP ASFPGLVAFT TNRAKYASGV DHTAPNETID GKRMAHGLAS SNATKKCSKD        60
     SPSQSVSVIF NRSSICELGM YLLRSYTDVS QLDRCRLLPY YLSTQLQALV RNQYAPSSTY       120
     LNETPNTFAV SLALDIIRQA PLAENETEGY CDHSMVMSNR LIWVV                       165
//

If you have problems or comments...

PBIL Back to PBIL home page