(data stored in ACNUC7421 zone)

EMBL: AM269963.PE36

AM269963.PE36        Location/Qualifiers
FT   CDS             join(99856..99971,100134..100325,100404..100611)
FT                   /locus_tag="An01g04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8L7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L7"
FT                   /protein_id="CAK37014.1"
FT                   /translation="MSCSRSFNKSCENMGSCYNAFNNQGSLGPEACTWGFSLWLVCWTT
FT                   CLPLYLTNFLRCQSWIVVDVPSTEPRYCVCGACRTEGEWAVSTHVQDQLPWEMDNRVDA
FT                   DWLFDGYVDEDGAFLVCSPHKTPSLAYAEYKKWIMIFLQTRFCRARVERPRELVRLVVA
FT                   ELAARKYW"
     MSCSRSFNKS CENMGSCYNA FNNQGSLGPE ACTWGFSLWL VCWTTCLPLY LTNFLRCQSW        60
     IVVDVPSTEP RYCVCGACRT EGEWAVSTHV QDQLPWEMDN RVDADWLFDG YVDEDGAFLV       120
     CSPHKTPSLA YAEYKKWIMI FLQTRFCRAR VERPRELVRL VVAELAARKY W                171
//

If you have problems or comments...

PBIL Back to PBIL home page