(data stored in ACNUC7421 zone)

EMBL: AM269963.PE37

AM269963.PE37        Location/Qualifiers
FT   CDS             join(101804..101938,102052..102204,102625..102676,
FT                   102763..102854)
FT                   /locus_tag="An01g04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8L8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L8"
FT                   /protein_id="CAK37015.1"
FT                   /translation="MDSIVWDKNPVASHAASNGEFQIRMPCCKGAVYNPRAGIVTTVEP
FT                   VIPTSLASGGMGDGERGWDGCVARDRGPFLLAFGVYHRWLVGLSVKQAGRDDPGSSSFL
FT                   LRSLATICRSWIVRPLDSDNLVGQLSSVLSVAPHAANIS"
     MDSIVWDKNP VASHAASNGE FQIRMPCCKG AVYNPRAGIV TTVEPVIPTS LASGGMGDGE        60
     RGWDGCVARD RGPFLLAFGV YHRWLVGLSV KQAGRDDPGS SSFLLRSLAT ICRSWIVRPL       120
     DSDNLVGQLS SVLSVAPHAA NIS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page