(data stored in ACNUC7421 zone)

EMBL: AM269963.PE38

AM269963.PE38        Location/Qualifiers
FT   CDS             join(103974..104053,104138..104245,104360..104460,
FT                   104881..105080,105162..105212)
FT                   /locus_tag="An01g04820"
FT                   /product="hypothetical protein"
FT                   /note="Remark: the ORF has an unusual exon/intron
FT                   structure."
FT                   /db_xref="GOA:A2Q8L9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L9"
FT                   /protein_id="CAK37016.1"
FT                   /translation="MVDGAELSYFAPLSPPRPIRIYAHTNAPSPRGLAGTPYVEGVCAL
FT                   GAVPGRIAYLVGGPPPPFIPGGTHPVDKYLSMVSESWCALAESQSHSNWESGGYPNPNL
FT                   AKSIIDHPLTSHTEILRHPIMWWESAQISTSRLCCANLVLLVASGSTLFQGGGVAAFSL
FT                   VGGVVVVVMTLPYYWG"
     MVDGAELSYF APLSPPRPIR IYAHTNAPSP RGLAGTPYVE GVCALGAVPG RIAYLVGGPP        60
     PPFIPGGTHP VDKYLSMVSE SWCALAESQS HSNWESGGYP NPNLAKSIID HPLTSHTEIL       120
     RHPIMWWESA QISTSRLCCA NLVLLVASGS TLFQGGGVAA FSLVGGVVVV VMTLPYYWG        179
//

If you have problems or comments...

PBIL Back to PBIL home page