(data stored in ACNUC7421 zone)

EMBL: AM269963.PE39

AM269963.PE39        Location/Qualifiers
FT   CDS             complement(112254..113183)
FT                   /locus_tag="An01g04830"
FT                   /note="Function: the flbD gene from Aspergillus nidulans
FT                   encodes a protein with a Myb-like DNA-binding domain that
FT                   is proposed to act in concert with other developmental
FT                   regulators to control initiation of conidiophore
FT                   development."
FT                   /note="Function: the flbD gene from Aspergillus nidulans is
FT                   involved in the coordination of initiation of conidiophore
FT                   development."
FT                   /note="Title: strong similarity to myb-like DNA binding
FT                   protein flbD - Aspergillus nidulans"
FT                   /note="nucleus"
FT                   /note="See PMID 7883170"
FT                   /note="See PMID 9539422"
FT                   /db_xref="GOA:A2Q8M0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M0"
FT                   /inference="profile:COGS:COG5147"
FT                   /inference="profile:PFAM:PF00249"
FT                   /inference="similar to AA sequence:UniProtKB:EN19882.1"
FT                   /protein_id="CAK37017.1"
FT                   /translation="MAPTHRRGPWVPEEDQLLLQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISAEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKRRGLPTSSSPHAGRTMHGRVEAPYARASLSMSSPISRSRYSSISNDRPLTSWTKSP
FT                   SSRRDSFSAASIDCPRQLTPIYTLPALNRPVETPLTSPAFSEASSMEPPSMISDHNSVS
FT                   SSSPRTIASPQLLPLPVDMRQQYGDFRRQSTSDDIYAYHDLSLKQRWISDHQQWNQHSP
FT                   LSPTWSAPIEDKTEAPRDSRMGLQNLLN"
     MAPTHRRGPW VPEEDQLLLQ LVREQGPNNW VRISQHMHYR SPKQCRERFH QNLKPSLNRE        60
     PISAEEGLMI ERMVNEMGKR WAEIARRLGN RSDNAVKNWW NGSMNRKRRG LPTSSSPHAG       120
     RTMHGRVEAP YARASLSMSS PISRSRYSSI SNDRPLTSWT KSPSSRRDSF SAASIDCPRQ       180
     LTPIYTLPAL NRPVETPLTS PAFSEASSME PPSMISDHNS VSSSSPRTIA SPQLLPLPVD       240
     MRQQYGDFRR QSTSDDIYAY HDLSLKQRWI SDHQQWNQHS PLSPTWSAPI EDKTEAPRDS       300
     RMGLQNLLN                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page