(data stored in ACNUC7421 zone)

EMBL: AM269963.PE4

AM269963.PE4         Location/Qualifiers
FT   CDS             join(6757..6769,6909..7106,7245..7361,7635..7684,
FT                   7902..8018)
FT                   /locus_tag="An01g04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8I5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I5"
FT                   /protein_id="CAK36982.1"
FT                   /translation="MVRPVNHFSEIEGKEKRGIKYEISRSWWWWSWGNQGEKGPKDQRV
FT                   RKLEIREDVKRGDTGDVKGTVDGAEMVVVRNQAKGREKTEKEEKEEDGRGEEKRKKTLE
FT                   TRGRREALRHGRLASSSSDPIEDGDDLTMQSTPPTSDGGCLGAEQINPGLDTYFVTRVE
FT                   S"
     MVRPVNHFSE IEGKEKRGIK YEISRSWWWW SWGNQGEKGP KDQRVRKLEI REDVKRGDTG        60
     DVKGTVDGAE MVVVRNQAKG REKTEKEEKE EDGRGEEKRK KTLETRGRRE ALRHGRLASS       120
     SSDPIEDGDD LTMQSTPPTS DGGCLGAEQI NPGLDTYFVT RVES                        164
//

If you have problems or comments...

PBIL Back to PBIL home page