(data stored in ACNUC7421 zone)

EMBL: AM269963.PE5

AM269963.PE5         Location/Qualifiers
FT   CDS             complement(11931..15797)
FT                   /locus_tag="An01g04470"
FT                   /note="Similarity: although some regions of the predicted
FT                   protein are very similar to S. pombe SPAC3H1. 12c, other
FT                   regions are absolutely not conserved."
FT                   /note="Similarity: the predicted protein contains several
FT                   structurale domains found in DNA-binding regulatory
FT                   proteins, like the BAH domain, the PHD-type zinc finger and
FT                   the Myb-like DNA-binding domain."
FT                   /note="Title: similarity to hypothetical protein YGL131c
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q8I6"
FT                   /db_xref="InterPro:IPR000949"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR029617"
FT                   /db_xref="InterPro:IPR034732"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I6"
FT                   /inference="profile:COGS:COG2319"
FT                   /inference="profile:COGS:COG5141"
FT                   /inference="profile:PFAM:PF00628"
FT                   /inference="similar to AA sequence:PIR:S64142"
FT                   /protein_id="CAK36983.1"
FT                   /translation="MYCVRPVLTKKPARGFAWACAACSRAQERKLEARNTPILGENQPE
FT                   ADEEMVEEEEEEPHGATNGTTSSTPAPVEEEVRPATEEQVAQARMWPYRYLGIHCRVED
FT                   ALDYDDRIYPRASSRLGPRHQAMVNAWPGKPVEYVKPIDIKKKYMRGSGGRKDSKLTKE
FT                   TVAAIEAAKQEKANRPKWVMDEPLGYVRRGEDEPVTVGGKQVRTAELMFKMPTADQVPS
FT                   SRGEDDAPGSHLSPAEREKFVDDYMERAKALAPQLGEEKYATNFLDKALELLYSNSFDA
FT                   DAALAKLKTMNKYKDLKEPHLRPEELKLFEQAVSKFGSEWRNITKYVGTVPHYQIVRFY
FT                   YMWKKTPRGRQIWGAYEGRRGKKEAKRSSAAKLVDDVADDHDDSAFDNDKAAEKKRGFQ
FT                   CKFCSTRTSRQWRRAPGTAPGTTTSSEPASKQRDKGSQLTVALCLRCALLWRKYGIQWE
FT                   SVDEVAKKIAQSGNKSWRRRVDEELLTQLLVSTETPISINSATAATAASIGVPVNANPQ
FT                   VQQETTKKKGGRTTEKDSAATSTATSVEPAPKKKVAADRIPEPPPIVPDPPRAKTLPCS
FT                   ICNKMEPEGDQHLSCRDCRLTVHRSCYGVSPSRNCVKWLCDMCSNDRDPMISTTYECVL
FT                   CPVTWTEHELMEAPRSTHKKKTERDREKERLEKEMVNEAIKLYRQRQEAVGKPIGPREP
FT                   LKRTAGNNWVHVTCAMWTPEIKFGNAKELEPAEGFGLIPRDKWRDVCKICKSDKGACVP
FT                   CHFNNCNARFHVGCAFQAQYKFGFDITPIKSSRRDTVNSVRLGEEVGSASAGIWCSHHP
FT                   VSATIHEIGEPTEEEGVNALRRYAEAYKQADLTLTGTIRKAAYVQQLINVSHQTATPSA
FT                   NRRVSSVHSVTAPPVVSAAPAAPAASTTPKDGHKTPEDAPDEMVIDSENHAPRPVADND
FT                   VTRKCARCSSSFSPRWWPLDKSRRTTGVDHRTPLLNGVGLNDPVGSRFSTASASPPYPH
FT                   QTPSQHALPRLNGEYSPEKTALSAINSEGPQTLYECHKCHLKKPVTQAQPSPEPRPSPY
FT                   SAQRPVLPAPKLTEYHNHPFGNHHRHPPQSGVLPRPIGLPHGGSEWHPSYEQRPADFGD
FT                   NKLRNGLPVPGYRAAAPPPPPPPAHHMNGFPPTPSHHAPPLSHYPPGSHAPPQPFPTHQ
FT                   SPYGPVSMPSPHLSHAAGPRPYAPSASPPDVHATMVRHSPQHSLSALNGGPPPRVYSVD
FT                   RVLGAPAQSPPVSQAHMDPRGPTPPVKPEDTPVIPSAARHTTASGTNGGSGASASPSLK
FT                   NLLS"
     MYCVRPVLTK KPARGFAWAC AACSRAQERK LEARNTPILG ENQPEADEEM VEEEEEEPHG        60
     ATNGTTSSTP APVEEEVRPA TEEQVAQARM WPYRYLGIHC RVEDALDYDD RIYPRASSRL       120
     GPRHQAMVNA WPGKPVEYVK PIDIKKKYMR GSGGRKDSKL TKETVAAIEA AKQEKANRPK       180
     WVMDEPLGYV RRGEDEPVTV GGKQVRTAEL MFKMPTADQV PSSRGEDDAP GSHLSPAERE       240
     KFVDDYMERA KALAPQLGEE KYATNFLDKA LELLYSNSFD ADAALAKLKT MNKYKDLKEP       300
     HLRPEELKLF EQAVSKFGSE WRNITKYVGT VPHYQIVRFY YMWKKTPRGR QIWGAYEGRR       360
     GKKEAKRSSA AKLVDDVADD HDDSAFDNDK AAEKKRGFQC KFCSTRTSRQ WRRAPGTAPG       420
     TTTSSEPASK QRDKGSQLTV ALCLRCALLW RKYGIQWESV DEVAKKIAQS GNKSWRRRVD       480
     EELLTQLLVS TETPISINSA TAATAASIGV PVNANPQVQQ ETTKKKGGRT TEKDSAATST       540
     ATSVEPAPKK KVAADRIPEP PPIVPDPPRA KTLPCSICNK MEPEGDQHLS CRDCRLTVHR       600
     SCYGVSPSRN CVKWLCDMCS NDRDPMISTT YECVLCPVTW TEHELMEAPR STHKKKTERD       660
     REKERLEKEM VNEAIKLYRQ RQEAVGKPIG PREPLKRTAG NNWVHVTCAM WTPEIKFGNA       720
     KELEPAEGFG LIPRDKWRDV CKICKSDKGA CVPCHFNNCN ARFHVGCAFQ AQYKFGFDIT       780
     PIKSSRRDTV NSVRLGEEVG SASAGIWCSH HPVSATIHEI GEPTEEEGVN ALRRYAEAYK       840
     QADLTLTGTI RKAAYVQQLI NVSHQTATPS ANRRVSSVHS VTAPPVVSAA PAAPAASTTP       900
     KDGHKTPEDA PDEMVIDSEN HAPRPVADND VTRKCARCSS SFSPRWWPLD KSRRTTGVDH       960
     RTPLLNGVGL NDPVGSRFST ASASPPYPHQ TPSQHALPRL NGEYSPEKTA LSAINSEGPQ      1020
     TLYECHKCHL KKPVTQAQPS PEPRPSPYSA QRPVLPAPKL TEYHNHPFGN HHRHPPQSGV      1080
     LPRPIGLPHG GSEWHPSYEQ RPADFGDNKL RNGLPVPGYR AAAPPPPPPP AHHMNGFPPT      1140
     PSHHAPPLSH YPPGSHAPPQ PFPTHQSPYG PVSMPSPHLS HAAGPRPYAP SASPPDVHAT      1200
     MVRHSPQHSL SALNGGPPPR VYSVDRVLGA PAQSPPVSQA HMDPRGPTPP VKPEDTPVIP      1260
     SAARHTTASG TNGGSGASAS PSLKNLLS                                         1288
//

If you have problems or comments...

PBIL Back to PBIL home page