(data stored in ACNUC7421 zone)

EMBL: AM269963.PE6

AM269963.PE6         Location/Qualifiers
FT   CDS             join(17358..17517,17694..17799,17870..18013,18106..18288,
FT                   18370..18434,18533..18587,18667..18795,18966..19071,
FT                   19247..19324)
FT                   /locus_tag="An01g04480"
FT                   /note="Title: weak similarity to gravin-like gl - Xenopus
FT                   laevis"
FT                   /note="See PMID 11165490"
FT                   /db_xref="GOA:A2Q8I7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I7"
FT                   /inference="similar to AA sequence:UniProtKB:AF308810.1"
FT                   /protein_id="CAK36984.1"
FT                   /translation="MHLRRGWFAFGCPQDRKSKGNTKLDGDDAEMQSSATGRDGETIPH
FT                   EKWGTLQPAACLSGLIPSVLPARAPKGSRLVGVKMGKNWDTPTGITKEQQEAGRKQTGG
FT                   GEGLPNCMNDEAKRRRGKKECRREEGKRGREKRLAAVEAKQAVEPLRALGDSWGEHRIR
FT                   SVLAPAASQISPVGGGGRKVRPQESYGISQSVRNVMMYAEPGLPKHGSKAQIHTDGEGN
FT                   GREEREEGRGRKKKDDQQLNWQVFRNPEGNASQKSERKKDRQMEMQQQPSRVEEEKESD
FT                   RSIGPSSYLRIPIPAISTHAWLQPALIPGPDGSTQHLAPLARPGGGVFDPLGDLRRDAE
FT                   F"
     MHLRRGWFAF GCPQDRKSKG NTKLDGDDAE MQSSATGRDG ETIPHEKWGT LQPAACLSGL        60
     IPSVLPARAP KGSRLVGVKM GKNWDTPTGI TKEQQEAGRK QTGGGEGLPN CMNDEAKRRR       120
     GKKECRREEG KRGREKRLAA VEAKQAVEPL RALGDSWGEH RIRSVLAPAA SQISPVGGGG       180
     RKVRPQESYG ISQSVRNVMM YAEPGLPKHG SKAQIHTDGE GNGREEREEG RGRKKKDDQQ       240
     LNWQVFRNPE GNASQKSERK KDRQMEMQQQ PSRVEEEKES DRSIGPSSYL RIPIPAISTH       300
     AWLQPALIPG PDGSTQHLAP LARPGGGVFD PLGDLRRDAE F                           341
//

If you have problems or comments...

PBIL Back to PBIL home page