(data stored in ACNUC7421 zone)

EMBL: AM269963.PE7

AM269963.PE7         Location/Qualifiers
FT   CDS             complement(join(20152..20288,20538..20787))
FT                   /locus_tag="An01g04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8I8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I8"
FT                   /protein_id="CAK36985.1"
FT                   /translation="MDRRSKLKDGEKGESGTMFQPRSPSGWPPAHCRVASAADVVNALR
FT                   LRDFIHDVAAAVAAANTIDQLPYPKKLILLDKDSAHIRFFPHMNKKTILRKETARRRTS
FT                   DRFLSCPADPAPGYDADAVSVVLD"
     MDRRSKLKDG EKGESGTMFQ PRSPSGWPPA HCRVASAADV VNALRLRDFI HDVAAAVAAA        60
     NTIDQLPYPK KLILLDKDSA HIRFFPHMNK KTILRKETAR RRTSDRFLSC PADPAPGYDA       120
     DAVSVVLD                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page