(data stored in ACNUC7421 zone)

EMBL: AM269963.PE8

AM269963.PE8         Location/Qualifiers
FT   CDS             complement(join(21152..21371,21654..21806,21879..21961))
FT                   /locus_tag="An01g04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8I9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I9"
FT                   /protein_id="CAK36986.1"
FT                   /translation="MGGVNHVAWVKGKGRLPALLRAVMWQQKSFQGPLVARRPGMPSCW
FT                   AYRDDGDDVTQASSKLIYLVKYGNSDYHSSRHLGPGAKGWAKFPLWWTDYCYHHLIAVA
FT                   GPHAPTSAVSCSTATSAVNWISFPSLPRVLERLVPARLVSRARITRK"
     MGGVNHVAWV KGKGRLPALL RAVMWQQKSF QGPLVARRPG MPSCWAYRDD GDDVTQASSK        60
     LIYLVKYGNS DYHSSRHLGP GAKGWAKFPL WWTDYCYHHL IAVAGPHAPT SAVSCSTATS       120
     AVNWISFPSL PRVLERLVPA RLVSRARITR K                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page