(data stored in ACNUC7421 zone)

EMBL: AM269963.PE9

AM269963.PE9         Location/Qualifiers
FT   CDS             join(23475..23488,23557..23689)
FT                   /locus_tag="An01g04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8J0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J0"
FT                   /protein_id="CAK36987.1"
FT                   /translation="MPVGSRASSPATLAYSPTFSLQSARGTGRNSVAAGFFPTSVPPDW
FT                   VAG"
     MPVGSRASSP ATLAYSPTFS LQSARGTGRN SVAAGFFPTS VPPDWVAG                     48
//

If you have problems or comments...

PBIL Back to PBIL home page