(data stored in ACNUC7421 zone)

EMBL: AM269963.PRPA

AM269963.PRPA        Location/Qualifiers
FT   CDS             complement(join(47604..48837,48903..48910,48972..49124))
FT                   /gene="prpA"
FT                   /locus_tag="An01g04600"
FT                   /product="PDI related protein A prpA-Aspergillus niger"
FT                   /EC_number="5.3.4.1"
FT                   /note="Function: the evidences suggesting the existence and
FT                   expression of prpA in A. niger are very strong, although no
FT                   function could be clearly demonstrated for the gene
FT                   product."
FT                   /note="Gene-ID: prpA"
FT                   /note="Phenotype: an A. niger strain containing a deletion
FT                   of the prpA gene is viable; however, deletion of the prpA
FT                   gene causes a reduction of exogenous proteins production."
FT                   /note="Similarity: prpA is similar to protein disulfide
FT                   isomerase (PDI), an enzyme important in assisting the
FT                   folding and maturation of secretory proteins in
FT                   eukaryotes."
FT                   /note="See PMID 9021130"
FT                   /note="See PMID 10653750"
FT                   /note="See PMID 10672446"
FT                   /db_xref="GOA:A2Q8J8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J8"
FT                   /inference="profile:COGS:COG0526"
FT                   /inference="profile:COGS:COG3118"
FT                   /inference="profile:PFAM:PF00085"
FT                   /inference="similar to AA sequence:UniProtKB:AF095899.1"
FT                   /protein_id="CAK36995.1"
FT                   /translation="MLQPSSALLFVTSLLAALPVNADGLYTKKSPVLQVNQKNYDQLIA
FT                   NSNHTSIVEFYAPWCGHCQNLKPAYEKAATNLDGLAKVAAVNCDYDDNKPFCGRMGVQG
FT                   FPTLKIVTPGKKPGKPRVEDYKGARSAKAIVEAVVDRIPNHVKRATDKDLDTWLAQDEE
FT                   SPKAILFTEKGTTSPLLRALAIDFLGSIQVAQVRNKETEAVEKFGITEFPTFVLLPGGG
FT                   QDPIVYDGELKKKPMVEFLSQAAAPNPDPAPKGSTAPRDNNKKKSTEPSPDSKIVSDEA
FT                   KPASVPIPAPPIGTLPTAEALEAACLMPKSGTCVLALLPEPSEPDAELPAPAKDALLSL
FT                   AEISHKHAVRKSKLFPFYSVPAINSGAKTLRAGLGLPEDNSVEIVAVNGRRGWWRRYDS
FT                   VEGAEYGQERVEAWIDAIRLGEGEKQKLPDGVVVEEVVEEKVEEKVEEVVEEPVEEKPA
FT                   VDHDEL"
     MLQPSSALLF VTSLLAALPV NADGLYTKKS PVLQVNQKNY DQLIANSNHT SIVEFYAPWC        60
     GHCQNLKPAY EKAATNLDGL AKVAAVNCDY DDNKPFCGRM GVQGFPTLKI VTPGKKPGKP       120
     RVEDYKGARS AKAIVEAVVD RIPNHVKRAT DKDLDTWLAQ DEESPKAILF TEKGTTSPLL       180
     RALAIDFLGS IQVAQVRNKE TEAVEKFGIT EFPTFVLLPG GGQDPIVYDG ELKKKPMVEF       240
     LSQAAAPNPD PAPKGSTAPR DNNKKKSTEP SPDSKIVSDE AKPASVPIPA PPIGTLPTAE       300
     ALEAACLMPK SGTCVLALLP EPSEPDAELP APAKDALLSL AEISHKHAVR KSKLFPFYSV       360
     PAINSGAKTL RAGLGLPEDN SVEIVAVNGR RGWWRRYDSV EGAEYGQERV EAWIDAIRLG       420
     EGEKQKLPDG VVVEEVVEEK VEEKVEEVVE EPVEEKPAVD HDEL                        464
//

If you have problems or comments...

PBIL Back to PBIL home page