(data stored in ACNUC7421 zone)

EMBL: AM269964.PE1

AM269964.PE1         Location/Qualifiers
FT   CDS             complement(join(300..525,838..1151,1314..1394))
FT                   /locus_tag="An01g04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8M1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M1"
FT                   /protein_id="CAK37018.1"
FT                   /translation="MNRGDGTAVPCLWCRGIQIEWASEHLCPVAPARRYSGPDSRLRMI
FT                   PMSIPTLPGMRQSQKIPNLQRALAGSAPITAPTQTVHVLGNGPRGVEEGSSLRPVRMRV
FT                   SGGQWALPAKGEAKSSRVTNRSIGVLTTRRGGGGGAGACPRSRYTLTPLCNHSEVLFVI
FT                   FPHLSQIGNLLPCPLLSLSLFFSFFLPFLPSIRISNSEVARPA"
     MNRGDGTAVP CLWCRGIQIE WASEHLCPVA PARRYSGPDS RLRMIPMSIP TLPGMRQSQK        60
     IPNLQRALAG SAPITAPTQT VHVLGNGPRG VEEGSSLRPV RMRVSGGQWA LPAKGEAKSS       120
     RVTNRSIGVL TTRRGGGGGA GACPRSRYTL TPLCNHSEVL FVIFPHLSQI GNLLPCPLLS       180
     LSLFFSFFLP FLPSIRISNS EVARPA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page