(data stored in ACNUC7421 zone)

EMBL: AM269964.PE10

AM269964.PE10        Location/Qualifiers
FT   CDS             join(19872..20003,20080..20102,20195..20325,20436..20524,
FT                   20589..20678,20734..20766)
FT                   /locus_tag="An01g04930"
FT                   /EC_number="3.6.3.14"
FT                   /note="Catalytic activity: S. cerevisiae ATP Synthase delta
FT                   chain produces ATP from ADP in the presence of a proton
FT                   gradient."
FT                   /note="Complex: S. cerevisiae ATP Synthase delta chain is
FT                   part of the catlytic heteromeric complex ATP-synthase."
FT                   /note="Function: S. cerevisiae ATP Synthase delta chain is
FT                   involved in ATP synthesis."
FT                   /note="Remark: the systematic name for ATP16 of S.
FT                   cerevisiae is YDL004W."
FT                   /note="Title: strong similarity to ATP synthase delta chain
FT                   Atp16 - Saccharomyces cerevisiae"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 8026496"
FT                   /db_xref="GOA:A2Q8N0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N0"
FT                   /inference="profile:COGS:COG0355"
FT                   /inference="profile:PFAM:PF02823"
FT                   /inference="similar to AA sequence:PIR:S45632"
FT                   /protein_id="CAK37027.1"
FT                   /translation="MSSLRFARSAFRARPSALRVPLQRRGYAEAVSDKIKLSLTLPHQS
FT                   IFKSTGVVQVNIPAESGEMGVLANHVPSIEQLKPGLVEIVEEGGASKKFFLSGGFAVVQ
FT                   PDSQLSINAVEGFPLEEFSIDNVRSQIAEAQKIANGSGSEQDIAEAKIELEVLESLQAV
FT                   LK"
     MSSLRFARSA FRARPSALRV PLQRRGYAEA VSDKIKLSLT LPHQSIFKST GVVQVNIPAE        60
     SGEMGVLANH VPSIEQLKPG LVEIVEEGGA SKKFFLSGGF AVVQPDSQLS INAVEGFPLE       120
     EFSIDNVRSQ IAEAQKIANG SGSEQDIAEA KIELEVLESL QAVLK                       165
//

If you have problems or comments...

PBIL Back to PBIL home page