(data stored in ACNUC7421 zone)

EMBL: AM269964.PE11

AM269964.PE11        Location/Qualifiers
FT   CDS             21100..22485
FT                   /locus_tag="An01g04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8N1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N1"
FT                   /protein_id="CAK37028.1"
FT                   /translation="MPSAFTKPVAIMQEPKSSDLEYPFCEGSDNPQNSSSQLQYKHPDD
FT                   CPARPIMTRSDTHDTDAFHIFPMDVDKEHSKNPSTSEYKMMGALFNKDTANRQGLPDLS
FT                   NDSVVLENWYESTTGPCSTLDRGTPSLARPENTTLVILNEKSLSERNSRGPVEAKSAWK
FT                   PPRPPKPRFLAHLDVAGFESYENSTPCPMPASRDGPGGHKWLAPRLLQGMDNDISKRRK
FT                   PWSDPKLGPSRYLSRPAKRGAKSYLTKNDLSQPFPGPWPSIDGLLLRQDSRIAKSSPAK
FT                   ICVRDHSNALSSPQEARESNVKRIGNWLGKLLSWVSHLSKLKERGVISISLVGQRSLQH
FT                   PRFGFASYEYSVSFKWSNTSGSIAIHQGQEEINLPAASKNATRLFRADITVPYLAMRIL
FT                   MGFCAVCRSRMSRGVMISFVRLFMRLIGLPVLYFLERLSVSLSIHPRESNTTQSARDQH
FT                   AVF"
     MPSAFTKPVA IMQEPKSSDL EYPFCEGSDN PQNSSSQLQY KHPDDCPARP IMTRSDTHDT        60
     DAFHIFPMDV DKEHSKNPST SEYKMMGALF NKDTANRQGL PDLSNDSVVL ENWYESTTGP       120
     CSTLDRGTPS LARPENTTLV ILNEKSLSER NSRGPVEAKS AWKPPRPPKP RFLAHLDVAG       180
     FESYENSTPC PMPASRDGPG GHKWLAPRLL QGMDNDISKR RKPWSDPKLG PSRYLSRPAK       240
     RGAKSYLTKN DLSQPFPGPW PSIDGLLLRQ DSRIAKSSPA KICVRDHSNA LSSPQEARES       300
     NVKRIGNWLG KLLSWVSHLS KLKERGVISI SLVGQRSLQH PRFGFASYEY SVSFKWSNTS       360
     GSIAIHQGQE EINLPAASKN ATRLFRADIT VPYLAMRILM GFCAVCRSRM SRGVMISFVR       420
     LFMRLIGLPV LYFLERLSVS LSIHPRESNT TQSARDQHAV F                           461
//

If you have problems or comments...

PBIL Back to PBIL home page