(data stored in ACNUC7421 zone)

EMBL: AM269964.PE12

AM269964.PE12        Location/Qualifiers
FT   CDS             complement(join(23105..24955,25010..25377,25428..25578))
FT                   /locus_tag="An01g04950"
FT                   /note="Similarity: similarity is from the N-terminal region
FT                   of the predicted A. niger protein to A. thaliana At2g30890
FT                   , which is 500aa shorter."
FT                   /note="Title: weak similarity to hypothetical protein
FT                   At2g30890 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8N2"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="InterPro:IPR007128"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N2"
FT                   /inference="similar to AA sequence:PIR:H84713"
FT                   /protein_id="CAK37029.1"
FT                   /translation="MTADSGLSAAGSSTYASNTLHVGDGTWDSERDTYLLPNLMGINFD
FT                   TMRYNGMGNRFKDMPEYHTLIVVHGVIATIVFLFLVPISVLIIRYYSRWNPFWAFKLHV
FT                   WCQVLTLLLSTVVFVFGWFAVGPKRSLTNPHHGIGLAIYVLVIFQILWGWLVHKIERNR
FT                   RSYHVPLKLVIHRWIGRALAILGLVQIPLGLTLYGSPKVLFILYAVVAFILLAVFFVLS
FT                   YLYDTEGYHMESGGYESRLSYVSGPSAADDHGHSNLGPMAAAGATGAGLASLFRRRSRG
FT                   RPHDYDESHTSFSDEKLSDEGPRRGGKGNLLLKLGAIGGGAWLAKKFFDRRRERDNDTE
FT                   SGRYSRAHTRSDSMTEESLSRLEDGRRPEPTAHTPLNRPPSRPPSRPPSRPPSRPPSRP
FT                   LSRPQSPGSSYLYNSTYLSEAPPRRPSHGLRDALLGAGALAAIKGFFSRRKGDAEQRRV
FT                   EEMRRREMEDERLARANSKRRYPGEGYYPRRDRPASFTATDLSTDLSRPPRGPPHGESI
FT                   VSAAGPPMASGAVDGARSDIPPAPGPPVPPPAASEYPGPAASTHGPTELASGVAAGTAL
FT                   GAASSAHRRRSASRHRSSSRPRSSSRHRDPIASPPVSVKLKMHNDGRHVTLRRLTDEEA
FT                   AASREARRRERRNSRRRAGSASSLSGNEGGSYDRWRRVEELERQQQEQMQREQAAAAAA
FT                   SSGFPATSAAPSSSMPPATSAYYAPPPQNGNGSHMPPPPPPPVPSSHPYGTGSIASPGT
FT                   FTGTEASGDYASNRRRRRAERARARQERQQHGVEFT"
     MTADSGLSAA GSSTYASNTL HVGDGTWDSE RDTYLLPNLM GINFDTMRYN GMGNRFKDMP        60
     EYHTLIVVHG VIATIVFLFL VPISVLIIRY YSRWNPFWAF KLHVWCQVLT LLLSTVVFVF       120
     GWFAVGPKRS LTNPHHGIGL AIYVLVIFQI LWGWLVHKIE RNRRSYHVPL KLVIHRWIGR       180
     ALAILGLVQI PLGLTLYGSP KVLFILYAVV AFILLAVFFV LSYLYDTEGY HMESGGYESR       240
     LSYVSGPSAA DDHGHSNLGP MAAAGATGAG LASLFRRRSR GRPHDYDESH TSFSDEKLSD       300
     EGPRRGGKGN LLLKLGAIGG GAWLAKKFFD RRRERDNDTE SGRYSRAHTR SDSMTEESLS       360
     RLEDGRRPEP TAHTPLNRPP SRPPSRPPSR PPSRPPSRPL SRPQSPGSSY LYNSTYLSEA       420
     PPRRPSHGLR DALLGAGALA AIKGFFSRRK GDAEQRRVEE MRRREMEDER LARANSKRRY       480
     PGEGYYPRRD RPASFTATDL STDLSRPPRG PPHGESIVSA AGPPMASGAV DGARSDIPPA       540
     PGPPVPPPAA SEYPGPAAST HGPTELASGV AAGTALGAAS SAHRRRSASR HRSSSRPRSS       600
     SRHRDPIASP PVSVKLKMHN DGRHVTLRRL TDEEAAASRE ARRRERRNSR RRAGSASSLS       660
     GNEGGSYDRW RRVEELERQQ QEQMQREQAA AAAASSGFPA TSAAPSSSMP PATSAYYAPP       720
     PQNGNGSHMP PPPPPPVPSS HPYGTGSIAS PGTFTGTEAS GDYASNRRRR RAERARARQE       780
     RQQHGVEFT                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page