(data stored in ACNUC7421 zone)

EMBL: AM269964.PE13

AM269964.PE13        Location/Qualifiers
FT   CDS             join(25864..25932,26097..26256,26339..26592)
FT                   /locus_tag="An01g04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8N3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N3"
FT                   /protein_id="CAK37030.1"
FT                   /translation="MEGGGGLGSMGNRDKRTVAGHQPPVSVYPGQPPADSAICRGRPPA
FT                   YVSMIVIDTIERTLADQGVTLFAMVDALINGRSVCCSMFAGDFQSTDPSYLINSSEAVG
FT                   LSVVLIVKLTLRSSRIDQGSSTKFRSINPPRNRSTRLARNPTPAISQQSWESGQAR"
     MEGGGGLGSM GNRDKRTVAG HQPPVSVYPG QPPADSAICR GRPPAYVSMI VIDTIERTLA        60
     DQGVTLFAMV DALINGRSVC CSMFAGDFQS TDPSYLINSS EAVGLSVVLI VKLTLRSSRI       120
     DQGSSTKFRS INPPRNRSTR LARNPTPAIS QQSWESGQAR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page